From 746a09a5854b9ce17e40caead51e1a42c2721bb1 Mon Sep 17 00:00:00 2001 From: Thomas Voss Date: Fri, 6 Jun 2025 02:49:26 +0200 Subject: Unvendor dependencies --- vendor/golang.org/x/text/internal/catmsg/catmsg.go | 417 --- vendor/golang.org/x/text/internal/catmsg/codec.go | 407 --- vendor/golang.org/x/text/internal/catmsg/varint.go | 62 - .../golang.org/x/text/internal/colltab/collelem.go | 376 --- .../golang.org/x/text/internal/colltab/colltab.go | 105 - .../golang.org/x/text/internal/colltab/contract.go | 145 - vendor/golang.org/x/text/internal/colltab/iter.go | 178 - .../golang.org/x/text/internal/colltab/numeric.go | 236 -- vendor/golang.org/x/text/internal/colltab/table.go | 275 -- vendor/golang.org/x/text/internal/colltab/trie.go | 159 - .../golang.org/x/text/internal/colltab/weighter.go | 31 - vendor/golang.org/x/text/internal/format/format.go | 41 - vendor/golang.org/x/text/internal/format/parser.go | 358 -- vendor/golang.org/x/text/internal/gen/code.go | 375 --- vendor/golang.org/x/text/internal/gen/gen.go | 354 -- vendor/golang.org/x/text/internal/internal.go | 49 - .../golang.org/x/text/internal/language/common.go | 16 - .../golang.org/x/text/internal/language/compact.go | 29 - .../x/text/internal/language/compact/compact.go | 61 - .../x/text/internal/language/compact/language.go | 260 -- .../x/text/internal/language/compact/parents.go | 120 - .../x/text/internal/language/compact/tables.go | 1015 ------ .../x/text/internal/language/compact/tags.go | 91 - .../golang.org/x/text/internal/language/compose.go | 167 - .../x/text/internal/language/coverage.go | 28 - .../x/text/internal/language/language.go | 627 ---- .../golang.org/x/text/internal/language/lookup.go | 412 --- .../golang.org/x/text/internal/language/match.go | 226 -- .../golang.org/x/text/internal/language/parse.go | 608 ---- .../golang.org/x/text/internal/language/tables.go | 3494 -------------------- vendor/golang.org/x/text/internal/language/tags.go | 48 - vendor/golang.org/x/text/internal/match.go | 67 - vendor/golang.org/x/text/internal/number/common.go | 55 - .../golang.org/x/text/internal/number/decimal.go | 500 --- vendor/golang.org/x/text/internal/number/format.go | 535 --- vendor/golang.org/x/text/internal/number/number.go | 152 - .../golang.org/x/text/internal/number/pattern.go | 485 --- .../x/text/internal/number/roundingmode_string.go | 30 - vendor/golang.org/x/text/internal/number/tables.go | 1219 ------- vendor/golang.org/x/text/internal/stringset/set.go | 86 - vendor/golang.org/x/text/internal/tag/tag.go | 100 - 41 files changed, 13999 deletions(-) delete mode 100644 vendor/golang.org/x/text/internal/catmsg/catmsg.go delete mode 100644 vendor/golang.org/x/text/internal/catmsg/codec.go delete mode 100644 vendor/golang.org/x/text/internal/catmsg/varint.go delete mode 100644 vendor/golang.org/x/text/internal/colltab/collelem.go delete mode 100644 vendor/golang.org/x/text/internal/colltab/colltab.go delete mode 100644 vendor/golang.org/x/text/internal/colltab/contract.go delete mode 100644 vendor/golang.org/x/text/internal/colltab/iter.go delete mode 100644 vendor/golang.org/x/text/internal/colltab/numeric.go delete mode 100644 vendor/golang.org/x/text/internal/colltab/table.go delete mode 100644 vendor/golang.org/x/text/internal/colltab/trie.go delete mode 100644 vendor/golang.org/x/text/internal/colltab/weighter.go delete mode 100644 vendor/golang.org/x/text/internal/format/format.go delete mode 100644 vendor/golang.org/x/text/internal/format/parser.go delete mode 100644 vendor/golang.org/x/text/internal/gen/code.go delete mode 100644 vendor/golang.org/x/text/internal/gen/gen.go delete mode 100644 vendor/golang.org/x/text/internal/internal.go delete mode 100644 vendor/golang.org/x/text/internal/language/common.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact/compact.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact/language.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact/parents.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact/tables.go delete mode 100644 vendor/golang.org/x/text/internal/language/compact/tags.go delete mode 100644 vendor/golang.org/x/text/internal/language/compose.go delete mode 100644 vendor/golang.org/x/text/internal/language/coverage.go delete mode 100644 vendor/golang.org/x/text/internal/language/language.go delete mode 100644 vendor/golang.org/x/text/internal/language/lookup.go delete mode 100644 vendor/golang.org/x/text/internal/language/match.go delete mode 100644 vendor/golang.org/x/text/internal/language/parse.go delete mode 100644 vendor/golang.org/x/text/internal/language/tables.go delete mode 100644 vendor/golang.org/x/text/internal/language/tags.go delete mode 100644 vendor/golang.org/x/text/internal/match.go delete mode 100644 vendor/golang.org/x/text/internal/number/common.go delete mode 100644 vendor/golang.org/x/text/internal/number/decimal.go delete mode 100644 vendor/golang.org/x/text/internal/number/format.go delete mode 100644 vendor/golang.org/x/text/internal/number/number.go delete mode 100644 vendor/golang.org/x/text/internal/number/pattern.go delete mode 100644 vendor/golang.org/x/text/internal/number/roundingmode_string.go delete mode 100644 vendor/golang.org/x/text/internal/number/tables.go delete mode 100644 vendor/golang.org/x/text/internal/stringset/set.go delete mode 100644 vendor/golang.org/x/text/internal/tag/tag.go (limited to 'vendor/golang.org/x/text/internal') diff --git a/vendor/golang.org/x/text/internal/catmsg/catmsg.go b/vendor/golang.org/x/text/internal/catmsg/catmsg.go deleted file mode 100644 index 1b257a7..0000000 --- a/vendor/golang.org/x/text/internal/catmsg/catmsg.go +++ /dev/null @@ -1,417 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package catmsg contains support types for package x/text/message/catalog. -// -// This package contains the low-level implementations of Message used by the -// catalog package and provides primitives for other packages to implement their -// own. For instance, the plural package provides functionality for selecting -// translation strings based on the plural category of substitution arguments. -// -// # Encoding and Decoding -// -// Catalogs store Messages encoded as a single string. Compiling a message into -// a string both results in compacter representation and speeds up evaluation. -// -// A Message must implement a Compile method to convert its arbitrary -// representation to a string. The Compile method takes an Encoder which -// facilitates serializing the message. Encoders also provide more context of -// the messages's creation (such as for which language the message is intended), -// which may not be known at the time of the creation of the message. -// -// Each message type must also have an accompanying decoder registered to decode -// the message. This decoder takes a Decoder argument which provides the -// counterparts for the decoding. -// -// # Renderers -// -// A Decoder must be initialized with a Renderer implementation. These -// implementations must be provided by packages that use Catalogs, typically -// formatting packages such as x/text/message. A typical user will not need to -// worry about this type; it is only relevant to packages that do string -// formatting and want to use the catalog package to handle localized strings. -// -// A package that uses catalogs for selecting strings receives selection results -// as sequence of substrings passed to the Renderer. The following snippet shows -// how to express the above example using the message package. -// -// message.Set(language.English, "You are %d minute(s) late.", -// catalog.Var("minutes", plural.Select(1, "one", "minute")), -// catalog.String("You are %[1]d ${minutes} late.")) -// -// p := message.NewPrinter(language.English) -// p.Printf("You are %d minute(s) late.", 5) // always 5 minutes late. -// -// To evaluate the Printf, package message wraps the arguments in a Renderer -// that is passed to the catalog for message decoding. The call sequence that -// results from evaluating the above message, assuming the person is rather -// tardy, is: -// -// Render("You are %[1]d ") -// Arg(1) -// Render("minutes") -// Render(" late.") -// -// The calls to Arg is caused by the plural.Select execution, which evaluates -// the argument to determine whether the singular or plural message form should -// be selected. The calls to Render reports the partial results to the message -// package for further evaluation. -package catmsg - -import ( - "errors" - "fmt" - "strconv" - "strings" - "sync" - - "golang.org/x/text/language" -) - -// A Handle refers to a registered message type. -type Handle int - -// A Handler decodes and evaluates data compiled by a Message and sends the -// result to the Decoder. The output may depend on the value of the substitution -// arguments, accessible by the Decoder's Arg method. The Handler returns false -// if there is no translation for the given substitution arguments. -type Handler func(d *Decoder) bool - -// Register records the existence of a message type and returns a Handle that -// can be used in the Encoder's EncodeMessageType method to create such -// messages. The prefix of the name should be the package path followed by -// an optional disambiguating string. -// Register will panic if a handle for the same name was already registered. -func Register(name string, handler Handler) Handle { - mutex.Lock() - defer mutex.Unlock() - - if _, ok := names[name]; ok { - panic(fmt.Errorf("catmsg: handler for %q already exists", name)) - } - h := Handle(len(handlers)) - names[name] = h - handlers = append(handlers, handler) - return h -} - -// These handlers require fixed positions in the handlers slice. -const ( - msgVars Handle = iota - msgFirst - msgRaw - msgString - msgAffix - // Leave some arbitrary room for future expansion: 20 should suffice. - numInternal = 20 -) - -const prefix = "golang.org/x/text/internal/catmsg." - -var ( - // TODO: find a more stable way to link handles to message types. - mutex sync.Mutex - names = map[string]Handle{ - prefix + "Vars": msgVars, - prefix + "First": msgFirst, - prefix + "Raw": msgRaw, - prefix + "String": msgString, - prefix + "Affix": msgAffix, - } - handlers = make([]Handler, numInternal) -) - -func init() { - // This handler is a message type wrapper that initializes a decoder - // with a variable block. This message type, if present, is always at the - // start of an encoded message. - handlers[msgVars] = func(d *Decoder) bool { - blockSize := int(d.DecodeUint()) - d.vars = d.data[:blockSize] - d.data = d.data[blockSize:] - return d.executeMessage() - } - - // First takes the first message in a sequence that results in a match for - // the given substitution arguments. - handlers[msgFirst] = func(d *Decoder) bool { - for !d.Done() { - if d.ExecuteMessage() { - return true - } - } - return false - } - - handlers[msgRaw] = func(d *Decoder) bool { - d.Render(d.data) - return true - } - - // A String message alternates between a string constant and a variable - // substitution. - handlers[msgString] = func(d *Decoder) bool { - for !d.Done() { - if str := d.DecodeString(); str != "" { - d.Render(str) - } - if d.Done() { - break - } - d.ExecuteSubstitution() - } - return true - } - - handlers[msgAffix] = func(d *Decoder) bool { - // TODO: use an alternative method for common cases. - prefix := d.DecodeString() - suffix := d.DecodeString() - if prefix != "" { - d.Render(prefix) - } - ret := d.ExecuteMessage() - if suffix != "" { - d.Render(suffix) - } - return ret - } -} - -var ( - // ErrIncomplete indicates a compiled message does not define translations - // for all possible argument values. If this message is returned, evaluating - // a message may result in the ErrNoMatch error. - ErrIncomplete = errors.New("catmsg: incomplete message; may not give result for all inputs") - - // ErrNoMatch indicates no translation message matched the given input - // parameters when evaluating a message. - ErrNoMatch = errors.New("catmsg: no translation for inputs") -) - -// A Message holds a collection of translations for the same phrase that may -// vary based on the values of substitution arguments. -type Message interface { - // Compile encodes the format string(s) of the message as a string for later - // evaluation. - // - // The first call Compile makes on the encoder must be EncodeMessageType. - // The handle passed to this call may either be a handle returned by - // Register to encode a single custom message, or HandleFirst followed by - // a sequence of calls to EncodeMessage. - // - // Compile must return ErrIncomplete if it is possible for evaluation to - // not match any translation for a given set of formatting parameters. - // For example, selecting a translation based on plural form may not yield - // a match if the form "Other" is not one of the selectors. - // - // Compile may return any other application-specific error. For backwards - // compatibility with package like fmt, which often do not do sanity - // checking of format strings ahead of time, Compile should still make an - // effort to have some sensible fallback in case of an error. - Compile(e *Encoder) error -} - -// Compile converts a Message to a data string that can be stored in a Catalog. -// The resulting string can subsequently be decoded by passing to the Execute -// method of a Decoder. -func Compile(tag language.Tag, macros Dictionary, m Message) (data string, err error) { - // TODO: pass macros so they can be used for validation. - v := &Encoder{inBody: true} // encoder for variables - v.root = v - e := &Encoder{root: v, parent: v, tag: tag} // encoder for messages - err = m.Compile(e) - // This package serves te message package, which in turn is meant to be a - // drop-in replacement for fmt. With the fmt package, format strings are - // evaluated lazily and errors are handled by substituting strings in the - // result, rather then returning an error. Dealing with multiple languages - // makes it more important to check errors ahead of time. We chose to be - // consistent and compatible and allow graceful degradation in case of - // errors. - buf := e.buf[stripPrefix(e.buf):] - if len(v.buf) > 0 { - // Prepend variable block. - b := make([]byte, 1+maxVarintBytes+len(v.buf)+len(buf)) - b[0] = byte(msgVars) - b = b[:1+encodeUint(b[1:], uint64(len(v.buf)))] - b = append(b, v.buf...) - b = append(b, buf...) - buf = b - } - if err == nil { - err = v.err - } - return string(buf), err -} - -// FirstOf is a message type that prints the first message in the sequence that -// resolves to a match for the given substitution arguments. -type FirstOf []Message - -// Compile implements Message. -func (s FirstOf) Compile(e *Encoder) error { - e.EncodeMessageType(msgFirst) - err := ErrIncomplete - for i, m := range s { - if err == nil { - return fmt.Errorf("catalog: message argument %d is complete and blocks subsequent messages", i-1) - } - err = e.EncodeMessage(m) - } - return err -} - -// Var defines a message that can be substituted for a placeholder of the same -// name. If an expression does not result in a string after evaluation, Name is -// used as the substitution. For example: -// -// Var{ -// Name: "minutes", -// Message: plural.Select(1, "one", "minute"), -// } -// -// will resolve to minute for singular and minutes for plural forms. -type Var struct { - Name string - Message Message -} - -var errIsVar = errors.New("catmsg: variable used as message") - -// Compile implements Message. -// -// Note that this method merely registers a variable; it does not create an -// encoded message. -func (v *Var) Compile(e *Encoder) error { - if err := e.addVar(v.Name, v.Message); err != nil { - return err - } - // Using a Var by itself is an error. If it is in a sequence followed by - // other messages referring to it, this error will be ignored. - return errIsVar -} - -// Raw is a message consisting of a single format string that is passed as is -// to the Renderer. -// -// Note that a Renderer may still do its own variable substitution. -type Raw string - -// Compile implements Message. -func (r Raw) Compile(e *Encoder) (err error) { - e.EncodeMessageType(msgRaw) - // Special case: raw strings don't have a size encoding and so don't use - // EncodeString. - e.buf = append(e.buf, r...) - return nil -} - -// String is a message consisting of a single format string which contains -// placeholders that may be substituted with variables. -// -// Variable substitutions are marked with placeholders and a variable name of -// the form ${name}. Any other substitutions such as Go templates or -// printf-style substitutions are left to be done by the Renderer. -// -// When evaluation a string interpolation, a Renderer will receive separate -// calls for each placeholder and interstitial string. For example, for the -// message: "%[1]v ${invites} %[2]v to ${their} party." The sequence of calls -// is: -// -// d.Render("%[1]v ") -// d.Arg(1) -// d.Render(resultOfInvites) -// d.Render(" %[2]v to ") -// d.Arg(2) -// d.Render(resultOfTheir) -// d.Render(" party.") -// -// where the messages for "invites" and "their" both use a plural.Select -// referring to the first argument. -// -// Strings may also invoke macros. Macros are essentially variables that can be -// reused. Macros may, for instance, be used to make selections between -// different conjugations of a verb. See the catalog package description for an -// overview of macros. -type String string - -// Compile implements Message. It parses the placeholder formats and returns -// any error. -func (s String) Compile(e *Encoder) (err error) { - msg := string(s) - const subStart = "${" - hasHeader := false - p := 0 - b := []byte{} - for { - i := strings.Index(msg[p:], subStart) - if i == -1 { - break - } - b = append(b, msg[p:p+i]...) - p += i + len(subStart) - if i = strings.IndexByte(msg[p:], '}'); i == -1 { - b = append(b, "$!(MISSINGBRACE)"...) - err = fmt.Errorf("catmsg: missing '}'") - p = len(msg) - break - } - name := strings.TrimSpace(msg[p : p+i]) - if q := strings.IndexByte(name, '('); q == -1 { - if !hasHeader { - hasHeader = true - e.EncodeMessageType(msgString) - } - e.EncodeString(string(b)) - e.EncodeSubstitution(name) - b = b[:0] - } else if j := strings.IndexByte(name[q:], ')'); j == -1 { - // TODO: what should the error be? - b = append(b, "$!(MISSINGPAREN)"...) - err = fmt.Errorf("catmsg: missing ')'") - } else if x, sErr := strconv.ParseUint(strings.TrimSpace(name[q+1:q+j]), 10, 32); sErr != nil { - // TODO: handle more than one argument - b = append(b, "$!(BADNUM)"...) - err = fmt.Errorf("catmsg: invalid number %q", strings.TrimSpace(name[q+1:q+j])) - } else { - if !hasHeader { - hasHeader = true - e.EncodeMessageType(msgString) - } - e.EncodeString(string(b)) - e.EncodeSubstitution(name[:q], int(x)) - b = b[:0] - } - p += i + 1 - } - b = append(b, msg[p:]...) - if !hasHeader { - // Simplify string to a raw string. - Raw(string(b)).Compile(e) - } else if len(b) > 0 { - e.EncodeString(string(b)) - } - return err -} - -// Affix is a message that adds a prefix and suffix to another message. -// This is mostly used add back whitespace to a translation that was stripped -// before sending it out. -type Affix struct { - Message Message - Prefix string - Suffix string -} - -// Compile implements Message. -func (a Affix) Compile(e *Encoder) (err error) { - // TODO: consider adding a special message type that just adds a single - // return. This is probably common enough to handle the majority of cases. - // Get some stats first, though. - e.EncodeMessageType(msgAffix) - e.EncodeString(a.Prefix) - e.EncodeString(a.Suffix) - e.EncodeMessage(a.Message) - return nil -} diff --git a/vendor/golang.org/x/text/internal/catmsg/codec.go b/vendor/golang.org/x/text/internal/catmsg/codec.go deleted file mode 100644 index 49c9fc9..0000000 --- a/vendor/golang.org/x/text/internal/catmsg/codec.go +++ /dev/null @@ -1,407 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package catmsg - -import ( - "errors" - "fmt" - - "golang.org/x/text/language" -) - -// A Renderer renders a Message. -type Renderer interface { - // Render renders the given string. The given string may be interpreted as a - // format string, such as the one used by the fmt package or a template. - Render(s string) - - // Arg returns the i-th argument passed to format a message. This method - // should return nil if there is no such argument. Messages need access to - // arguments to allow selecting a message based on linguistic features of - // those arguments. - Arg(i int) interface{} -} - -// A Dictionary specifies a source of messages, including variables or macros. -type Dictionary interface { - // Lookup returns the message for the given key. It returns false for ok if - // such a message could not be found. - Lookup(key string) (data string, ok bool) - - // TODO: consider returning an interface, instead of a string. This will - // allow implementations to do their own message type decoding. -} - -// An Encoder serializes a Message to a string. -type Encoder struct { - // The root encoder is used for storing encoded variables. - root *Encoder - // The parent encoder provides the surrounding scopes for resolving variable - // names. - parent *Encoder - - tag language.Tag - - // buf holds the encoded message so far. After a message completes encoding, - // the contents of buf, prefixed by the encoded length, are flushed to the - // parent buffer. - buf []byte - - // vars is the lookup table of variables in the current scope. - vars []keyVal - - err error - inBody bool // if false next call must be EncodeMessageType -} - -type keyVal struct { - key string - offset int -} - -// Language reports the language for which the encoded message will be stored -// in the Catalog. -func (e *Encoder) Language() language.Tag { return e.tag } - -func (e *Encoder) setError(err error) { - if e.root.err == nil { - e.root.err = err - } -} - -// EncodeUint encodes x. -func (e *Encoder) EncodeUint(x uint64) { - e.checkInBody() - var buf [maxVarintBytes]byte - n := encodeUint(buf[:], x) - e.buf = append(e.buf, buf[:n]...) -} - -// EncodeString encodes s. -func (e *Encoder) EncodeString(s string) { - e.checkInBody() - e.EncodeUint(uint64(len(s))) - e.buf = append(e.buf, s...) -} - -// EncodeMessageType marks the current message to be of type h. -// -// It must be the first call of a Message's Compile method. -func (e *Encoder) EncodeMessageType(h Handle) { - if e.inBody { - panic("catmsg: EncodeMessageType not the first method called") - } - e.inBody = true - e.EncodeUint(uint64(h)) -} - -// EncodeMessage serializes the given message inline at the current position. -func (e *Encoder) EncodeMessage(m Message) error { - e = &Encoder{root: e.root, parent: e, tag: e.tag} - err := m.Compile(e) - if _, ok := m.(*Var); !ok { - e.flushTo(e.parent) - } - return err -} - -func (e *Encoder) checkInBody() { - if !e.inBody { - panic("catmsg: expected prior call to EncodeMessageType") - } -} - -// stripPrefix indicates the number of prefix bytes that must be stripped to -// turn a single-element sequence into a message that is just this single member -// without its size prefix. If the message can be stripped, b[1:n] contains the -// size prefix. -func stripPrefix(b []byte) (n int) { - if len(b) > 0 && Handle(b[0]) == msgFirst { - x, n, _ := decodeUint(b[1:]) - if 1+n+int(x) == len(b) { - return 1 + n - } - } - return 0 -} - -func (e *Encoder) flushTo(dst *Encoder) { - data := e.buf - p := stripPrefix(data) - if p > 0 { - data = data[1:] - } else { - // Prefix the size. - dst.EncodeUint(uint64(len(data))) - } - dst.buf = append(dst.buf, data...) -} - -func (e *Encoder) addVar(key string, m Message) error { - for _, v := range e.parent.vars { - if v.key == key { - err := fmt.Errorf("catmsg: duplicate variable %q", key) - e.setError(err) - return err - } - } - scope := e.parent - // If a variable message is Incomplete, and does not evaluate to a message - // during execution, we fall back to the variable name. We encode this by - // appending the variable name if the message reports it's incomplete. - - err := m.Compile(e) - if err != ErrIncomplete { - e.setError(err) - } - switch { - case len(e.buf) == 1 && Handle(e.buf[0]) == msgFirst: // empty sequence - e.buf = e.buf[:0] - e.inBody = false - fallthrough - case len(e.buf) == 0: - // Empty message. - if err := String(key).Compile(e); err != nil { - e.setError(err) - } - case err == ErrIncomplete: - if Handle(e.buf[0]) != msgFirst { - seq := &Encoder{root: e.root, parent: e} - seq.EncodeMessageType(msgFirst) - e.flushTo(seq) - e = seq - } - // e contains a sequence; append the fallback string. - e.EncodeMessage(String(key)) - } - - // Flush result to variable heap. - offset := len(e.root.buf) - e.flushTo(e.root) - e.buf = e.buf[:0] - - // Record variable offset in current scope. - scope.vars = append(scope.vars, keyVal{key: key, offset: offset}) - return err -} - -const ( - substituteVar = iota - substituteMacro - substituteError -) - -// EncodeSubstitution inserts a resolved reference to a variable or macro. -// -// This call must be matched with a call to ExecuteSubstitution at decoding -// time. -func (e *Encoder) EncodeSubstitution(name string, arguments ...int) { - if arity := len(arguments); arity > 0 { - // TODO: also resolve macros. - e.EncodeUint(substituteMacro) - e.EncodeString(name) - for _, a := range arguments { - e.EncodeUint(uint64(a)) - } - return - } - for scope := e; scope != nil; scope = scope.parent { - for _, v := range scope.vars { - if v.key != name { - continue - } - e.EncodeUint(substituteVar) // TODO: support arity > 0 - e.EncodeUint(uint64(v.offset)) - return - } - } - // TODO: refer to dictionary-wide scoped variables. - e.EncodeUint(substituteError) - e.EncodeString(name) - e.setError(fmt.Errorf("catmsg: unknown var %q", name)) -} - -// A Decoder deserializes and evaluates messages that are encoded by an encoder. -type Decoder struct { - tag language.Tag - dst Renderer - macros Dictionary - - err error - vars string - data string - - macroArg int // TODO: allow more than one argument -} - -// NewDecoder returns a new Decoder. -// -// Decoders are designed to be reused for multiple invocations of Execute. -// Only one goroutine may call Execute concurrently. -func NewDecoder(tag language.Tag, r Renderer, macros Dictionary) *Decoder { - return &Decoder{ - tag: tag, - dst: r, - macros: macros, - } -} - -func (d *Decoder) setError(err error) { - if d.err == nil { - d.err = err - } -} - -// Language returns the language in which the message is being rendered. -// -// The destination language may be a child language of the language used for -// encoding. For instance, a decoding language of "pt-PT"" is consistent with an -// encoding language of "pt". -func (d *Decoder) Language() language.Tag { return d.tag } - -// Done reports whether there are more bytes to process in this message. -func (d *Decoder) Done() bool { return len(d.data) == 0 } - -// Render implements Renderer. -func (d *Decoder) Render(s string) { d.dst.Render(s) } - -// Arg implements Renderer. -// -// During evaluation of macros, the argument positions may be mapped to -// arguments that differ from the original call. -func (d *Decoder) Arg(i int) interface{} { - if d.macroArg != 0 { - if i != 1 { - panic("catmsg: only macros with single argument supported") - } - i = d.macroArg - } - return d.dst.Arg(i) -} - -// DecodeUint decodes a number that was encoded with EncodeUint and advances the -// position. -func (d *Decoder) DecodeUint() uint64 { - x, n, err := decodeUintString(d.data) - d.data = d.data[n:] - if err != nil { - d.setError(err) - } - return x -} - -// DecodeString decodes a string that was encoded with EncodeString and advances -// the position. -func (d *Decoder) DecodeString() string { - size := d.DecodeUint() - s := d.data[:size] - d.data = d.data[size:] - return s -} - -// SkipMessage skips the message at the current location and advances the -// position. -func (d *Decoder) SkipMessage() { - n := int(d.DecodeUint()) - d.data = d.data[n:] -} - -// Execute decodes and evaluates msg. -// -// Only one goroutine may call execute. -func (d *Decoder) Execute(msg string) error { - d.err = nil - if !d.execute(msg) { - return ErrNoMatch - } - return d.err -} - -func (d *Decoder) execute(msg string) bool { - saved := d.data - d.data = msg - ok := d.executeMessage() - d.data = saved - return ok -} - -// executeMessageFromData is like execute, but also decodes a leading message -// size and clips the given string accordingly. -// -// It reports the number of bytes consumed and whether a message was selected. -func (d *Decoder) executeMessageFromData(s string) (n int, ok bool) { - saved := d.data - d.data = s - size := int(d.DecodeUint()) - n = len(s) - len(d.data) - // Sanitize the setting. This allows skipping a size argument for - // RawString and method Done. - d.data = d.data[:size] - ok = d.executeMessage() - n += size - len(d.data) - d.data = saved - return n, ok -} - -var errUnknownHandler = errors.New("catmsg: string contains unsupported handler") - -// executeMessage reads the handle id, initializes the decoder and executes the -// message. It is assumed that all of d.data[d.p:] is the single message. -func (d *Decoder) executeMessage() bool { - if d.Done() { - // We interpret no data as a valid empty message. - return true - } - handle := d.DecodeUint() - - var fn Handler - mutex.Lock() - if int(handle) < len(handlers) { - fn = handlers[handle] - } - mutex.Unlock() - if fn == nil { - d.setError(errUnknownHandler) - d.execute(fmt.Sprintf("\x02$!(UNKNOWNMSGHANDLER=%#x)", handle)) - return true - } - return fn(d) -} - -// ExecuteMessage decodes and executes the message at the current position. -func (d *Decoder) ExecuteMessage() bool { - n, ok := d.executeMessageFromData(d.data) - d.data = d.data[n:] - return ok -} - -// ExecuteSubstitution executes the message corresponding to the substitution -// as encoded by EncodeSubstitution. -func (d *Decoder) ExecuteSubstitution() { - switch x := d.DecodeUint(); x { - case substituteVar: - offset := d.DecodeUint() - d.executeMessageFromData(d.vars[offset:]) - case substituteMacro: - name := d.DecodeString() - data, ok := d.macros.Lookup(name) - old := d.macroArg - // TODO: support macros of arity other than 1. - d.macroArg = int(d.DecodeUint()) - switch { - case !ok: - // TODO: detect this at creation time. - d.setError(fmt.Errorf("catmsg: undefined macro %q", name)) - fallthrough - case !d.execute(data): - d.dst.Render(name) // fall back to macro name. - } - d.macroArg = old - case substituteError: - d.dst.Render(d.DecodeString()) - default: - panic("catmsg: unreachable") - } -} diff --git a/vendor/golang.org/x/text/internal/catmsg/varint.go b/vendor/golang.org/x/text/internal/catmsg/varint.go deleted file mode 100644 index a2cee2c..0000000 --- a/vendor/golang.org/x/text/internal/catmsg/varint.go +++ /dev/null @@ -1,62 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package catmsg - -// This file implements varint encoding analogous to the one in encoding/binary. -// We need a string version of this function, so we add that here and then add -// the rest for consistency. - -import "errors" - -var ( - errIllegalVarint = errors.New("catmsg: illegal varint") - errVarintTooLarge = errors.New("catmsg: varint too large for uint64") -) - -const maxVarintBytes = 10 // maximum length of a varint - -// encodeUint encodes x as a variable-sized integer into buf and returns the -// number of bytes written. buf must be at least maxVarintBytes long -func encodeUint(buf []byte, x uint64) (n int) { - for ; x > 127; n++ { - buf[n] = 0x80 | uint8(x&0x7F) - x >>= 7 - } - buf[n] = uint8(x) - n++ - return n -} - -func decodeUintString(s string) (x uint64, size int, err error) { - i := 0 - for shift := uint(0); shift < 64; shift += 7 { - if i >= len(s) { - return 0, i, errIllegalVarint - } - b := uint64(s[i]) - i++ - x |= (b & 0x7F) << shift - if b&0x80 == 0 { - return x, i, nil - } - } - return 0, i, errVarintTooLarge -} - -func decodeUint(b []byte) (x uint64, size int, err error) { - i := 0 - for shift := uint(0); shift < 64; shift += 7 { - if i >= len(b) { - return 0, i, errIllegalVarint - } - c := uint64(b[i]) - i++ - x |= (c & 0x7F) << shift - if c&0x80 == 0 { - return x, i, nil - } - } - return 0, i, errVarintTooLarge -} diff --git a/vendor/golang.org/x/text/internal/colltab/collelem.go b/vendor/golang.org/x/text/internal/colltab/collelem.go deleted file mode 100644 index 0c23c8a..0000000 --- a/vendor/golang.org/x/text/internal/colltab/collelem.go +++ /dev/null @@ -1,376 +0,0 @@ -// Copyright 2012 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package colltab - -import ( - "fmt" - "unicode" -) - -// Level identifies the collation comparison level. -// The primary level corresponds to the basic sorting of text. -// The secondary level corresponds to accents and related linguistic elements. -// The tertiary level corresponds to casing and related concepts. -// The quaternary level is derived from the other levels by the -// various algorithms for handling variable elements. -type Level int - -const ( - Primary Level = iota - Secondary - Tertiary - Quaternary - Identity - - NumLevels -) - -const ( - defaultSecondary = 0x20 - defaultTertiary = 0x2 - maxTertiary = 0x1F - MaxQuaternary = 0x1FFFFF // 21 bits. -) - -// Elem is a representation of a collation element. This API provides ways to encode -// and decode Elems. Implementations of collation tables may use values greater -// or equal to PrivateUse for their own purposes. However, these should never be -// returned by AppendNext. -type Elem uint32 - -const ( - maxCE Elem = 0xAFFFFFFF - PrivateUse = minContract - minContract = 0xC0000000 - maxContract = 0xDFFFFFFF - minExpand = 0xE0000000 - maxExpand = 0xEFFFFFFF - minDecomp = 0xF0000000 -) - -type ceType int - -const ( - ceNormal ceType = iota // ceNormal includes implicits (ce == 0) - ceContractionIndex // rune can be a start of a contraction - ceExpansionIndex // rune expands into a sequence of collation elements - ceDecompose // rune expands using NFKC decomposition -) - -func (ce Elem) ctype() ceType { - if ce <= maxCE { - return ceNormal - } - if ce <= maxContract { - return ceContractionIndex - } else { - if ce <= maxExpand { - return ceExpansionIndex - } - return ceDecompose - } - panic("should not reach here") - return ceType(-1) -} - -// For normal collation elements, we assume that a collation element either has -// a primary or non-default secondary value, not both. -// Collation elements with a primary value are of the form -// -// 01pppppp pppppppp ppppppp0 ssssssss -// - p* is primary collation value -// - s* is the secondary collation value -// 00pppppp pppppppp ppppppps sssttttt, where -// - p* is primary collation value -// - s* offset of secondary from default value. -// - t* is the tertiary collation value -// 100ttttt cccccccc pppppppp pppppppp -// - t* is the tertiar collation value -// - c* is the canonical combining class -// - p* is the primary collation value -// -// Collation elements with a secondary value are of the form -// -// 1010cccc ccccssss ssssssss tttttttt, where -// - c* is the canonical combining class -// - s* is the secondary collation value -// - t* is the tertiary collation value -// 11qqqqqq qqqqqqqq qqqqqqq0 00000000 -// - q* quaternary value -const ( - ceTypeMask = 0xC0000000 - ceTypeMaskExt = 0xE0000000 - ceIgnoreMask = 0xF00FFFFF - ceType1 = 0x40000000 - ceType2 = 0x00000000 - ceType3or4 = 0x80000000 - ceType4 = 0xA0000000 - ceTypeQ = 0xC0000000 - Ignore = ceType4 - firstNonPrimary = 0x80000000 - lastSpecialPrimary = 0xA0000000 - secondaryMask = 0x80000000 - hasTertiaryMask = 0x40000000 - primaryValueMask = 0x3FFFFE00 - maxPrimaryBits = 21 - compactPrimaryBits = 16 - maxSecondaryBits = 12 - maxTertiaryBits = 8 - maxCCCBits = 8 - maxSecondaryCompactBits = 8 - maxSecondaryDiffBits = 4 - maxTertiaryCompactBits = 5 - primaryShift = 9 - compactSecondaryShift = 5 - minCompactSecondary = defaultSecondary - 4 -) - -func makeImplicitCE(primary int) Elem { - return ceType1 | Elem(primary<= 1<= %x", w, 1<= 1<= %x", w, 1<= 1<= %x", w, 1<= 1<= %x", primary, 1<= 1<= %x", secondary, 1<= 1< %x", d, d, 1<= 1< %x", tertiary, 1<> 16) - } - return uint8(ce >> 20) - } - return 0 -} - -// Primary returns the primary collation weight for ce. -func (ce Elem) Primary() int { - if ce >= firstNonPrimary { - if ce > lastSpecialPrimary { - return 0 - } - return int(uint16(ce)) - } - return int(ce&primaryValueMask) >> primaryShift -} - -// Secondary returns the secondary collation weight for ce. -func (ce Elem) Secondary() int { - switch ce & ceTypeMask { - case ceType1: - return int(uint8(ce)) - case ceType2: - return minCompactSecondary + int((ce>>compactSecondaryShift)&0xF) - case ceType3or4: - if ce < ceType4 { - return defaultSecondary - } - return int(ce>>8) & 0xFFF - case ceTypeQ: - return 0 - } - panic("should not reach here") -} - -// Tertiary returns the tertiary collation weight for ce. -func (ce Elem) Tertiary() uint8 { - if ce&hasTertiaryMask == 0 { - if ce&ceType3or4 == 0 { - return uint8(ce & 0x1F) - } - if ce&ceType4 == ceType4 { - return uint8(ce) - } - return uint8(ce>>24) & 0x1F // type 2 - } else if ce&ceTypeMask == ceType1 { - return defaultTertiary - } - // ce is a quaternary value. - return 0 -} - -func (ce Elem) updateTertiary(t uint8) Elem { - if ce&ceTypeMask == ceType1 { - // convert to type 4 - nce := ce & primaryValueMask - nce |= Elem(uint8(ce)-minCompactSecondary) << compactSecondaryShift - ce = nce - } else if ce&ceTypeMaskExt == ceType3or4 { - ce &= ^Elem(maxTertiary << 24) - return ce | (Elem(t) << 24) - } else { - // type 2 or 4 - ce &= ^Elem(maxTertiary) - } - return ce | Elem(t) -} - -// Quaternary returns the quaternary value if explicitly specified, -// 0 if ce == Ignore, or MaxQuaternary otherwise. -// Quaternary values are used only for shifted variants. -func (ce Elem) Quaternary() int { - if ce&ceTypeMask == ceTypeQ { - return int(ce&primaryValueMask) >> primaryShift - } else if ce&ceIgnoreMask == Ignore { - return 0 - } - return MaxQuaternary -} - -// Weight returns the collation weight for the given level. -func (ce Elem) Weight(l Level) int { - switch l { - case Primary: - return ce.Primary() - case Secondary: - return ce.Secondary() - case Tertiary: - return int(ce.Tertiary()) - case Quaternary: - return ce.Quaternary() - } - return 0 // return 0 (ignore) for undefined levels. -} - -// For contractions, collation elements are of the form -// 110bbbbb bbbbbbbb iiiiiiii iiiinnnn, where -// - n* is the size of the first node in the contraction trie. -// - i* is the index of the first node in the contraction trie. -// - b* is the offset into the contraction collation element table. -// -// See contract.go for details on the contraction trie. -const ( - maxNBits = 4 - maxTrieIndexBits = 12 - maxContractOffsetBits = 13 -) - -func splitContractIndex(ce Elem) (index, n, offset int) { - n = int(ce & (1<>= maxNBits - index = int(ce & (1<>= maxTrieIndexBits - offset = int(ce & (1<> 8) -} - -const ( - // These constants were taken from https://www.unicode.org/versions/Unicode6.0.0/ch12.pdf. - minUnified rune = 0x4E00 - maxUnified = 0x9FFF - minCompatibility = 0xF900 - maxCompatibility = 0xFAFF - minRare = 0x3400 - maxRare = 0x4DBF -) -const ( - commonUnifiedOffset = 0x10000 - rareUnifiedOffset = 0x20000 // largest rune in common is U+FAFF - otherOffset = 0x50000 // largest rune in rare is U+2FA1D - illegalOffset = otherOffset + int(unicode.MaxRune) - maxPrimary = illegalOffset + 1 -) - -// implicitPrimary returns the primary weight for the a rune -// for which there is no entry for the rune in the collation table. -// We take a different approach from the one specified in -// https://unicode.org/reports/tr10/#Implicit_Weights, -// but preserve the resulting relative ordering of the runes. -func implicitPrimary(r rune) int { - if unicode.Is(unicode.Ideographic, r) { - if r >= minUnified && r <= maxUnified { - // The most common case for CJK. - return int(r) + commonUnifiedOffset - } - if r >= minCompatibility && r <= maxCompatibility { - // This will typically not hit. The DUCET explicitly specifies mappings - // for all characters that do not decompose. - return int(r) + commonUnifiedOffset - } - return int(r) + rareUnifiedOffset - } - return int(r) + otherOffset -} diff --git a/vendor/golang.org/x/text/internal/colltab/colltab.go b/vendor/golang.org/x/text/internal/colltab/colltab.go deleted file mode 100644 index 02f2247..0000000 --- a/vendor/golang.org/x/text/internal/colltab/colltab.go +++ /dev/null @@ -1,105 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package colltab contains functionality related to collation tables. -// It is only to be used by the collate and search packages. -package colltab // import "golang.org/x/text/internal/colltab" - -import ( - "sort" - - "golang.org/x/text/language" -) - -// MatchLang finds the index of t in tags, using a matching algorithm used for -// collation and search. tags[0] must be language.Und, the remaining tags should -// be sorted alphabetically. -// -// Language matching for collation and search is different from the matching -// defined by language.Matcher: the (inferred) base language must be an exact -// match for the relevant fields. For example, "gsw" should not match "de". -// Also the parent relation is different, as a parent may have a different -// script. So usually the parent of zh-Hant is und, whereas for MatchLang it is -// zh. -func MatchLang(t language.Tag, tags []language.Tag) int { - // Canonicalize the values, including collapsing macro languages. - t, _ = language.All.Canonicalize(t) - - base, conf := t.Base() - // Estimate the base language, but only use high-confidence values. - if conf < language.High { - // The root locale supports "search" and "standard". We assume that any - // implementation will only use one of both. - return 0 - } - - // Maximize base and script and normalize the tag. - if _, s, r := t.Raw(); (r != language.Region{}) { - p, _ := language.Raw.Compose(base, s, r) - // Taking the parent forces the script to be maximized. - p = p.Parent() - // Add back region and extensions. - t, _ = language.Raw.Compose(p, r, t.Extensions()) - } else { - // Set the maximized base language. - t, _ = language.Raw.Compose(base, s, t.Extensions()) - } - - // Find start index of the language tag. - start := 1 + sort.Search(len(tags)-1, func(i int) bool { - b, _, _ := tags[i+1].Raw() - return base.String() <= b.String() - }) - if start < len(tags) { - if b, _, _ := tags[start].Raw(); b != base { - return 0 - } - } - - // Besides the base language, script and region, only the collation type and - // the custom variant defined in the 'u' extension are used to distinguish a - // locale. - // Strip all variants and extensions and add back the custom variant. - tdef, _ := language.Raw.Compose(t.Raw()) - tdef, _ = tdef.SetTypeForKey("va", t.TypeForKey("va")) - - // First search for a specialized collation type, if present. - try := []language.Tag{tdef} - if co := t.TypeForKey("co"); co != "" { - tco, _ := tdef.SetTypeForKey("co", co) - try = []language.Tag{tco, tdef} - } - - for _, tx := range try { - for ; tx != language.Und; tx = parent(tx) { - for i, t := range tags[start:] { - if b, _, _ := t.Raw(); b != base { - break - } - if tx == t { - return start + i - } - } - } - } - return 0 -} - -// parent computes the structural parent. This means inheritance may change -// script. So, unlike the CLDR parent, parent(zh-Hant) == zh. -func parent(t language.Tag) language.Tag { - if t.TypeForKey("va") != "" { - t, _ = t.SetTypeForKey("va", "") - return t - } - result := language.Und - if b, s, r := t.Raw(); (r != language.Region{}) { - result, _ = language.Raw.Compose(b, s, t.Extensions()) - } else if (s != language.Script{}) { - result, _ = language.Raw.Compose(b, t.Extensions()) - } else if (b != language.Base{}) { - result, _ = language.Raw.Compose(t.Extensions()) - } - return result -} diff --git a/vendor/golang.org/x/text/internal/colltab/contract.go b/vendor/golang.org/x/text/internal/colltab/contract.go deleted file mode 100644 index 25649d4..0000000 --- a/vendor/golang.org/x/text/internal/colltab/contract.go +++ /dev/null @@ -1,145 +0,0 @@ -// Copyright 2012 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package colltab - -import "unicode/utf8" - -// For a description of ContractTrieSet, see text/collate/build/contract.go. - -type ContractTrieSet []struct{ L, H, N, I uint8 } - -// ctScanner is used to match a trie to an input sequence. -// A contraction may match a non-contiguous sequence of bytes in an input string. -// For example, if there is a contraction for , it should match -// the sequence , as combining_cedilla does -// not block combining_ring. -// ctScanner does not automatically skip over non-blocking non-starters, but rather -// retains the state of the last match and leaves it up to the user to continue -// the match at the appropriate points. -type ctScanner struct { - states ContractTrieSet - s []byte - n int - index int - pindex int - done bool -} - -type ctScannerString struct { - states ContractTrieSet - s string - n int - index int - pindex int - done bool -} - -func (t ContractTrieSet) scanner(index, n int, b []byte) ctScanner { - return ctScanner{s: b, states: t[index:], n: n} -} - -func (t ContractTrieSet) scannerString(index, n int, str string) ctScannerString { - return ctScannerString{s: str, states: t[index:], n: n} -} - -// result returns the offset i and bytes consumed p so far. If no suffix -// matched, i and p will be 0. -func (s *ctScanner) result() (i, p int) { - return s.index, s.pindex -} - -func (s *ctScannerString) result() (i, p int) { - return s.index, s.pindex -} - -const ( - final = 0 - noIndex = 0xFF -) - -// scan matches the longest suffix at the current location in the input -// and returns the number of bytes consumed. -func (s *ctScanner) scan(p int) int { - pr := p // the p at the rune start - str := s.s - states, n := s.states, s.n - for i := 0; i < n && p < len(str); { - e := states[i] - c := str[p] - // TODO: a significant number of contractions are of a form that - // cannot match discontiguous UTF-8 in a normalized string. We could let - // a negative value of e.n mean that we can set s.done = true and avoid - // the need for additional matches. - if c >= e.L { - if e.L == c { - p++ - if e.I != noIndex { - s.index = int(e.I) - s.pindex = p - } - if e.N != final { - i, states, n = 0, states[int(e.H)+n:], int(e.N) - if p >= len(str) || utf8.RuneStart(str[p]) { - s.states, s.n, pr = states, n, p - } - } else { - s.done = true - return p - } - continue - } else if e.N == final && c <= e.H { - p++ - s.done = true - s.index = int(c-e.L) + int(e.I) - s.pindex = p - return p - } - } - i++ - } - return pr -} - -// scan is a verbatim copy of ctScanner.scan. -func (s *ctScannerString) scan(p int) int { - pr := p // the p at the rune start - str := s.s - states, n := s.states, s.n - for i := 0; i < n && p < len(str); { - e := states[i] - c := str[p] - // TODO: a significant number of contractions are of a form that - // cannot match discontiguous UTF-8 in a normalized string. We could let - // a negative value of e.n mean that we can set s.done = true and avoid - // the need for additional matches. - if c >= e.L { - if e.L == c { - p++ - if e.I != noIndex { - s.index = int(e.I) - s.pindex = p - } - if e.N != final { - i, states, n = 0, states[int(e.H)+n:], int(e.N) - if p >= len(str) || utf8.RuneStart(str[p]) { - s.states, s.n, pr = states, n, p - } - } else { - s.done = true - return p - } - continue - } else if e.N == final && c <= e.H { - p++ - s.done = true - s.index = int(c-e.L) + int(e.I) - s.pindex = p - return p - } - } - i++ - } - return pr -} diff --git a/vendor/golang.org/x/text/internal/colltab/iter.go b/vendor/golang.org/x/text/internal/colltab/iter.go deleted file mode 100644 index c1b1ba8..0000000 --- a/vendor/golang.org/x/text/internal/colltab/iter.go +++ /dev/null @@ -1,178 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package colltab - -// An Iter incrementally converts chunks of the input text to collation -// elements, while ensuring that the collation elements are in normalized order -// (that is, they are in the order as if the input text were normalized first). -type Iter struct { - Weighter Weighter - Elems []Elem - // N is the number of elements in Elems that will not be reordered on - // subsequent iterations, N <= len(Elems). - N int - - bytes []byte - str string - // Because the Elems buffer may contain collation elements that are needed - // for look-ahead, we need two positions in the text (bytes or str): one for - // the end position in the text for the current iteration and one for the - // start of the next call to appendNext. - pEnd int // end position in text corresponding to N. - pNext int // pEnd <= pNext. -} - -// Reset sets the position in the current input text to p and discards any -// results obtained so far. -func (i *Iter) Reset(p int) { - i.Elems = i.Elems[:0] - i.N = 0 - i.pEnd = p - i.pNext = p -} - -// Len returns the length of the input text. -func (i *Iter) Len() int { - if i.bytes != nil { - return len(i.bytes) - } - return len(i.str) -} - -// Discard removes the collation elements up to N. -func (i *Iter) Discard() { - // TODO: change this such that only modifiers following starters will have - // to be copied. - i.Elems = i.Elems[:copy(i.Elems, i.Elems[i.N:])] - i.N = 0 -} - -// End returns the end position of the input text for which Next has returned -// results. -func (i *Iter) End() int { - return i.pEnd -} - -// SetInput resets i to input s. -func (i *Iter) SetInput(s []byte) { - i.bytes = s - i.str = "" - i.Reset(0) -} - -// SetInputString resets i to input s. -func (i *Iter) SetInputString(s string) { - i.str = s - i.bytes = nil - i.Reset(0) -} - -func (i *Iter) done() bool { - return i.pNext >= len(i.str) && i.pNext >= len(i.bytes) -} - -func (i *Iter) appendNext() bool { - if i.done() { - return false - } - var sz int - if i.bytes == nil { - i.Elems, sz = i.Weighter.AppendNextString(i.Elems, i.str[i.pNext:]) - } else { - i.Elems, sz = i.Weighter.AppendNext(i.Elems, i.bytes[i.pNext:]) - } - if sz == 0 { - sz = 1 - } - i.pNext += sz - return true -} - -// Next appends Elems to the internal array. On each iteration, it will either -// add starters or modifiers. In the majority of cases, an Elem with a primary -// value > 0 will have a CCC of 0. The CCC values of collation elements are also -// used to detect if the input string was not normalized and to adjust the -// result accordingly. -func (i *Iter) Next() bool { - if i.N == len(i.Elems) && !i.appendNext() { - return false - } - - // Check if the current segment starts with a starter. - prevCCC := i.Elems[len(i.Elems)-1].CCC() - if prevCCC == 0 { - i.N = len(i.Elems) - i.pEnd = i.pNext - return true - } else if i.Elems[i.N].CCC() == 0 { - // set i.N to only cover part of i.Elems for which prevCCC == 0 and - // use rest for the next call to next. - for i.N++; i.N < len(i.Elems) && i.Elems[i.N].CCC() == 0; i.N++ { - } - i.pEnd = i.pNext - return true - } - - // The current (partial) segment starts with modifiers. We need to collect - // all successive modifiers to ensure that they are normalized. - for { - p := len(i.Elems) - i.pEnd = i.pNext - if !i.appendNext() { - break - } - - if ccc := i.Elems[p].CCC(); ccc == 0 || len(i.Elems)-i.N > maxCombiningCharacters { - // Leave the starter for the next iteration. This ensures that we - // do not return sequences of collation elements that cross two - // segments. - // - // TODO: handle large number of combining characters by fully - // normalizing the input segment before iteration. This ensures - // results are consistent across the text repo. - i.N = p - return true - } else if ccc < prevCCC { - i.doNorm(p, ccc) // should be rare, never occurs for NFD and FCC. - } else { - prevCCC = ccc - } - } - - done := len(i.Elems) != i.N - i.N = len(i.Elems) - return done -} - -// nextNoNorm is the same as next, but does not "normalize" the collation -// elements. -func (i *Iter) nextNoNorm() bool { - // TODO: remove this function. Using this instead of next does not seem - // to improve performance in any significant way. We retain this until - // later for evaluation purposes. - if i.done() { - return false - } - i.appendNext() - i.N = len(i.Elems) - return true -} - -const maxCombiningCharacters = 30 - -// doNorm reorders the collation elements in i.Elems. -// It assumes that blocks of collation elements added with appendNext -// either start and end with the same CCC or start with CCC == 0. -// This allows for a single insertion point for the entire block. -// The correctness of this assumption is verified in builder.go. -func (i *Iter) doNorm(p int, ccc uint8) { - n := len(i.Elems) - k := p - for p--; p > i.N && ccc < i.Elems[p-1].CCC(); p-- { - } - i.Elems = append(i.Elems, i.Elems[p:k]...) - copy(i.Elems[p:], i.Elems[k:]) - i.Elems = i.Elems[:n] -} diff --git a/vendor/golang.org/x/text/internal/colltab/numeric.go b/vendor/golang.org/x/text/internal/colltab/numeric.go deleted file mode 100644 index 53b819c..0000000 --- a/vendor/golang.org/x/text/internal/colltab/numeric.go +++ /dev/null @@ -1,236 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package colltab - -import ( - "unicode" - "unicode/utf8" -) - -// NewNumericWeighter wraps w to replace individual digits to sort based on their -// numeric value. -// -// Weighter w must have a free primary weight after the primary weight for 9. -// If this is not the case, numeric value will sort at the same primary level -// as the first primary sorting after 9. -func NewNumericWeighter(w Weighter) Weighter { - getElem := func(s string) Elem { - elems, _ := w.AppendNextString(nil, s) - return elems[0] - } - nine := getElem("9") - - // Numbers should order before zero, but the DUCET has no room for this. - // TODO: move before zero once we use fractional collation elements. - ns, _ := MakeElem(nine.Primary()+1, nine.Secondary(), int(nine.Tertiary()), 0) - - return &numericWeighter{ - Weighter: w, - - // We assume that w sorts digits of different kinds in order of numeric - // value and that the tertiary weight order is preserved. - // - // TODO: evaluate whether it is worth basing the ranges on the Elem - // encoding itself once the move to fractional weights is complete. - zero: getElem("0"), - zeroSpecialLo: getElem("0"), // U+FF10 FULLWIDTH DIGIT ZERO - zeroSpecialHi: getElem("₀"), // U+2080 SUBSCRIPT ZERO - nine: nine, - nineSpecialHi: getElem("₉"), // U+2089 SUBSCRIPT NINE - numberStart: ns, - } -} - -// A numericWeighter translates a stream of digits into a stream of weights -// representing the numeric value. -type numericWeighter struct { - Weighter - - // The Elems below all demarcate boundaries of specific ranges. With the - // current element encoding digits are in two ranges: normal (default - // tertiary value) and special. For most languages, digits have collation - // elements in the normal range. - // - // Note: the range tests are very specific for the element encoding used by - // this implementation. The tests in collate_test.go are designed to fail - // if this code is not updated when an encoding has changed. - - zero Elem // normal digit zero - zeroSpecialLo Elem // special digit zero, low tertiary value - zeroSpecialHi Elem // special digit zero, high tertiary value - nine Elem // normal digit nine - nineSpecialHi Elem // special digit nine - numberStart Elem -} - -// AppendNext calls the namesake of the underlying weigher, but replaces single -// digits with weights representing their value. -func (nw *numericWeighter) AppendNext(buf []Elem, s []byte) (ce []Elem, n int) { - ce, n = nw.Weighter.AppendNext(buf, s) - nc := numberConverter{ - elems: buf, - w: nw, - b: s, - } - isZero, ok := nc.checkNextDigit(ce) - if !ok { - return ce, n - } - // ce might have been grown already, so take it instead of buf. - nc.init(ce, len(buf), isZero) - for n < len(s) { - ce, sz := nw.Weighter.AppendNext(nc.elems, s[n:]) - nc.b = s - n += sz - if !nc.update(ce) { - break - } - } - return nc.result(), n -} - -// AppendNextString calls the namesake of the underlying weigher, but replaces -// single digits with weights representing their value. -func (nw *numericWeighter) AppendNextString(buf []Elem, s string) (ce []Elem, n int) { - ce, n = nw.Weighter.AppendNextString(buf, s) - nc := numberConverter{ - elems: buf, - w: nw, - s: s, - } - isZero, ok := nc.checkNextDigit(ce) - if !ok { - return ce, n - } - nc.init(ce, len(buf), isZero) - for n < len(s) { - ce, sz := nw.Weighter.AppendNextString(nc.elems, s[n:]) - nc.s = s - n += sz - if !nc.update(ce) { - break - } - } - return nc.result(), n -} - -type numberConverter struct { - w *numericWeighter - - elems []Elem - nDigits int - lenIndex int - - s string // set if the input was of type string - b []byte // set if the input was of type []byte -} - -// init completes initialization of a numberConverter and prepares it for adding -// more digits. elems is assumed to have a digit starting at oldLen. -func (nc *numberConverter) init(elems []Elem, oldLen int, isZero bool) { - // Insert a marker indicating the start of a number and a placeholder - // for the number of digits. - if isZero { - elems = append(elems[:oldLen], nc.w.numberStart, 0) - } else { - elems = append(elems, 0, 0) - copy(elems[oldLen+2:], elems[oldLen:]) - elems[oldLen] = nc.w.numberStart - elems[oldLen+1] = 0 - - nc.nDigits = 1 - } - nc.elems = elems - nc.lenIndex = oldLen + 1 -} - -// checkNextDigit reports whether bufNew adds a single digit relative to the old -// buffer. If it does, it also reports whether this digit is zero. -func (nc *numberConverter) checkNextDigit(bufNew []Elem) (isZero, ok bool) { - if len(nc.elems) >= len(bufNew) { - return false, false - } - e := bufNew[len(nc.elems)] - if e < nc.w.zeroSpecialLo || nc.w.nine < e { - // Not a number. - return false, false - } - if e < nc.w.zero { - if e > nc.w.nineSpecialHi { - // Not a number. - return false, false - } - if !nc.isDigit() { - return false, false - } - isZero = e <= nc.w.zeroSpecialHi - } else { - // This is the common case if we encounter a digit. - isZero = e == nc.w.zero - } - // Test the remaining added collation elements have a zero primary value. - if n := len(bufNew) - len(nc.elems); n > 1 { - for i := len(nc.elems) + 1; i < len(bufNew); i++ { - if bufNew[i].Primary() != 0 { - return false, false - } - } - // In some rare cases, collation elements will encode runes in - // unicode.No as a digit. For example Ethiopic digits (U+1369 - U+1371) - // are not in Nd. Also some digits that clearly belong in unicode.No, - // like U+0C78 TELUGU FRACTION DIGIT ZERO FOR ODD POWERS OF FOUR, have - // collation elements indistinguishable from normal digits. - // Unfortunately, this means we need to make this check for nearly all - // non-Latin digits. - // - // TODO: check the performance impact and find something better if it is - // an issue. - if !nc.isDigit() { - return false, false - } - } - return isZero, true -} - -func (nc *numberConverter) isDigit() bool { - if nc.b != nil { - r, _ := utf8.DecodeRune(nc.b) - return unicode.In(r, unicode.Nd) - } - r, _ := utf8.DecodeRuneInString(nc.s) - return unicode.In(r, unicode.Nd) -} - -// We currently support a maximum of about 2M digits (the number of primary -// values). Such numbers will compare correctly against small numbers, but their -// comparison against other large numbers is undefined. -// -// TODO: define a proper fallback, such as comparing large numbers textually or -// actually allowing numbers of unlimited length. -// -// TODO: cap this to a lower number (like 100) and maybe allow a larger number -// in an option? -const maxDigits = 1<= firstHangul && r <= lastHangul { - // TODO: performance can be considerably improved here. - n = sz - var buf [16]byte // Used for decomposing Hangul. - for b := src.nfd(buf[:0], hangulSize); len(b) > 0; b = b[sz:] { - ce, sz = t.Index.lookup(b) - w = append(w, ce) - } - return w, n - } - ce = makeImplicitCE(implicitPrimary(r)) - } - w = append(w, ce) - } else if tp == ceExpansionIndex { - w = t.appendExpansion(w, ce) - } else if tp == ceContractionIndex { - n := 0 - src.tail(sz) - if src.bytes == nil { - w, n = t.matchContractionString(w, ce, src.str) - } else { - w, n = t.matchContraction(w, ce, src.bytes) - } - sz += n - } else if tp == ceDecompose { - // Decompose using NFKD and replace tertiary weights. - t1, t2 := splitDecompose(ce) - i := len(w) - nfkd := src.properties(norm.NFKD).Decomposition() - for p := 0; len(nfkd) > 0; nfkd = nfkd[p:] { - w, p = t.appendNext(w, source{bytes: nfkd}) - } - w[i] = w[i].updateTertiary(t1) - if i++; i < len(w) { - w[i] = w[i].updateTertiary(t2) - for i++; i < len(w); i++ { - w[i] = w[i].updateTertiary(maxTertiary) - } - } - } - return w, sz -} - -func (t *Table) appendExpansion(w []Elem, ce Elem) []Elem { - i := splitExpandIndex(ce) - n := int(t.ExpandElem[i]) - i++ - for _, ce := range t.ExpandElem[i : i+n] { - w = append(w, Elem(ce)) - } - return w -} - -func (t *Table) matchContraction(w []Elem, ce Elem, suffix []byte) ([]Elem, int) { - index, n, offset := splitContractIndex(ce) - - scan := t.ContractTries.scanner(index, n, suffix) - buf := [norm.MaxSegmentSize]byte{} - bufp := 0 - p := scan.scan(0) - - if !scan.done && p < len(suffix) && suffix[p] >= utf8.RuneSelf { - // By now we should have filtered most cases. - p0 := p - bufn := 0 - rune := norm.NFD.Properties(suffix[p:]) - p += rune.Size() - if rune.LeadCCC() != 0 { - prevCC := rune.TrailCCC() - // A gap may only occur in the last normalization segment. - // This also ensures that len(scan.s) < norm.MaxSegmentSize. - if end := norm.NFD.FirstBoundary(suffix[p:]); end != -1 { - scan.s = suffix[:p+end] - } - for p < len(suffix) && !scan.done && suffix[p] >= utf8.RuneSelf { - rune = norm.NFD.Properties(suffix[p:]) - if ccc := rune.LeadCCC(); ccc == 0 || prevCC >= ccc { - break - } - prevCC = rune.TrailCCC() - if pp := scan.scan(p); pp != p { - // Copy the interstitial runes for later processing. - bufn += copy(buf[bufn:], suffix[p0:p]) - if scan.pindex == pp { - bufp = bufn - } - p, p0 = pp, pp - } else { - p += rune.Size() - } - } - } - } - // Append weights for the matched contraction, which may be an expansion. - i, n := scan.result() - ce = Elem(t.ContractElem[i+offset]) - if ce.ctype() == ceNormal { - w = append(w, ce) - } else { - w = t.appendExpansion(w, ce) - } - // Append weights for the runes in the segment not part of the contraction. - for b, p := buf[:bufp], 0; len(b) > 0; b = b[p:] { - w, p = t.appendNext(w, source{bytes: b}) - } - return w, n -} - -// TODO: unify the two implementations. This is best done after first simplifying -// the algorithm taking into account the inclusion of both NFC and NFD forms -// in the table. -func (t *Table) matchContractionString(w []Elem, ce Elem, suffix string) ([]Elem, int) { - index, n, offset := splitContractIndex(ce) - - scan := t.ContractTries.scannerString(index, n, suffix) - buf := [norm.MaxSegmentSize]byte{} - bufp := 0 - p := scan.scan(0) - - if !scan.done && p < len(suffix) && suffix[p] >= utf8.RuneSelf { - // By now we should have filtered most cases. - p0 := p - bufn := 0 - rune := norm.NFD.PropertiesString(suffix[p:]) - p += rune.Size() - if rune.LeadCCC() != 0 { - prevCC := rune.TrailCCC() - // A gap may only occur in the last normalization segment. - // This also ensures that len(scan.s) < norm.MaxSegmentSize. - if end := norm.NFD.FirstBoundaryInString(suffix[p:]); end != -1 { - scan.s = suffix[:p+end] - } - for p < len(suffix) && !scan.done && suffix[p] >= utf8.RuneSelf { - rune = norm.NFD.PropertiesString(suffix[p:]) - if ccc := rune.LeadCCC(); ccc == 0 || prevCC >= ccc { - break - } - prevCC = rune.TrailCCC() - if pp := scan.scan(p); pp != p { - // Copy the interstitial runes for later processing. - bufn += copy(buf[bufn:], suffix[p0:p]) - if scan.pindex == pp { - bufp = bufn - } - p, p0 = pp, pp - } else { - p += rune.Size() - } - } - } - } - // Append weights for the matched contraction, which may be an expansion. - i, n := scan.result() - ce = Elem(t.ContractElem[i+offset]) - if ce.ctype() == ceNormal { - w = append(w, ce) - } else { - w = t.appendExpansion(w, ce) - } - // Append weights for the runes in the segment not part of the contraction. - for b, p := buf[:bufp], 0; len(b) > 0; b = b[p:] { - w, p = t.appendNext(w, source{bytes: b}) - } - return w, n -} diff --git a/vendor/golang.org/x/text/internal/colltab/trie.go b/vendor/golang.org/x/text/internal/colltab/trie.go deleted file mode 100644 index a0eaa0d..0000000 --- a/vendor/golang.org/x/text/internal/colltab/trie.go +++ /dev/null @@ -1,159 +0,0 @@ -// Copyright 2012 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// The trie in this file is used to associate the first full character in an -// UTF-8 string to a collation element. All but the last byte in a UTF-8 byte -// sequence are used to lookup offsets in the index table to be used for the -// next byte. The last byte is used to index into a table of collation elements. -// For a full description, see go.text/collate/build/trie.go. - -package colltab - -const blockSize = 64 - -type Trie struct { - Index0 []uint16 // index for first byte (0xC0-0xFF) - Values0 []uint32 // index for first byte (0x00-0x7F) - Index []uint16 - Values []uint32 -} - -const ( - t1 = 0x00 // 0000 0000 - tx = 0x80 // 1000 0000 - t2 = 0xC0 // 1100 0000 - t3 = 0xE0 // 1110 0000 - t4 = 0xF0 // 1111 0000 - t5 = 0xF8 // 1111 1000 - t6 = 0xFC // 1111 1100 - te = 0xFE // 1111 1110 -) - -func (t *Trie) lookupValue(n uint16, b byte) Elem { - return Elem(t.Values[int(n)<<6+int(b)]) -} - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *Trie) lookup(s []byte) (v Elem, sz int) { - c0 := s[0] - switch { - case c0 < tx: - return Elem(t.Values0[c0]), 1 - case c0 < t2: - return 0, 1 - case c0 < t3: - if len(s) < 2 { - return 0, 0 - } - i := t.Index0[c0] - c1 := s[1] - if c1 < tx || t2 <= c1 { - return 0, 1 - } - return t.lookupValue(i, c1), 2 - case c0 < t4: - if len(s) < 3 { - return 0, 0 - } - i := t.Index0[c0] - c1 := s[1] - if c1 < tx || t2 <= c1 { - return 0, 1 - } - o := int(i)<<6 + int(c1) - i = t.Index[o] - c2 := s[2] - if c2 < tx || t2 <= c2 { - return 0, 2 - } - return t.lookupValue(i, c2), 3 - case c0 < t5: - if len(s) < 4 { - return 0, 0 - } - i := t.Index0[c0] - c1 := s[1] - if c1 < tx || t2 <= c1 { - return 0, 1 - } - o := int(i)<<6 + int(c1) - i = t.Index[o] - c2 := s[2] - if c2 < tx || t2 <= c2 { - return 0, 2 - } - o = int(i)<<6 + int(c2) - i = t.Index[o] - c3 := s[3] - if c3 < tx || t2 <= c3 { - return 0, 3 - } - return t.lookupValue(i, c3), 4 - } - // Illegal rune - return 0, 1 -} - -// The body of lookupString is a verbatim copy of that of lookup. -func (t *Trie) lookupString(s string) (v Elem, sz int) { - c0 := s[0] - switch { - case c0 < tx: - return Elem(t.Values0[c0]), 1 - case c0 < t2: - return 0, 1 - case c0 < t3: - if len(s) < 2 { - return 0, 0 - } - i := t.Index0[c0] - c1 := s[1] - if c1 < tx || t2 <= c1 { - return 0, 1 - } - return t.lookupValue(i, c1), 2 - case c0 < t4: - if len(s) < 3 { - return 0, 0 - } - i := t.Index0[c0] - c1 := s[1] - if c1 < tx || t2 <= c1 { - return 0, 1 - } - o := int(i)<<6 + int(c1) - i = t.Index[o] - c2 := s[2] - if c2 < tx || t2 <= c2 { - return 0, 2 - } - return t.lookupValue(i, c2), 3 - case c0 < t5: - if len(s) < 4 { - return 0, 0 - } - i := t.Index0[c0] - c1 := s[1] - if c1 < tx || t2 <= c1 { - return 0, 1 - } - o := int(i)<<6 + int(c1) - i = t.Index[o] - c2 := s[2] - if c2 < tx || t2 <= c2 { - return 0, 2 - } - o = int(i)<<6 + int(c2) - i = t.Index[o] - c3 := s[3] - if c3 < tx || t2 <= c3 { - return 0, 3 - } - return t.lookupValue(i, c3), 4 - } - // Illegal rune - return 0, 1 -} diff --git a/vendor/golang.org/x/text/internal/colltab/weighter.go b/vendor/golang.org/x/text/internal/colltab/weighter.go deleted file mode 100644 index f1ec45f..0000000 --- a/vendor/golang.org/x/text/internal/colltab/weighter.go +++ /dev/null @@ -1,31 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package colltab // import "golang.org/x/text/internal/colltab" - -// A Weighter can be used as a source for Collator and Searcher. -type Weighter interface { - // Start finds the start of the segment that includes position p. - Start(p int, b []byte) int - - // StartString finds the start of the segment that includes position p. - StartString(p int, s string) int - - // AppendNext appends Elems to buf corresponding to the longest match - // of a single character or contraction from the start of s. - // It returns the new buf and the number of bytes consumed. - AppendNext(buf []Elem, s []byte) (ce []Elem, n int) - - // AppendNextString appends Elems to buf corresponding to the longest match - // of a single character or contraction from the start of s. - // It returns the new buf and the number of bytes consumed. - AppendNextString(buf []Elem, s string) (ce []Elem, n int) - - // Domain returns a slice of all single characters and contractions for which - // collation elements are defined in this table. - Domain() []string - - // Top returns the highest variable primary value. - Top() uint32 -} diff --git a/vendor/golang.org/x/text/internal/format/format.go b/vendor/golang.org/x/text/internal/format/format.go deleted file mode 100644 index ee1c57a..0000000 --- a/vendor/golang.org/x/text/internal/format/format.go +++ /dev/null @@ -1,41 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package format contains types for defining language-specific formatting of -// values. -// -// This package is internal now, but will eventually be exposed after the API -// settles. -package format // import "golang.org/x/text/internal/format" - -import ( - "fmt" - - "golang.org/x/text/language" -) - -// State represents the printer state passed to custom formatters. It provides -// access to the fmt.State interface and the sentence and language-related -// context. -type State interface { - fmt.State - - // Language reports the requested language in which to render a message. - Language() language.Tag - - // TODO: consider this and removing rune from the Format method in the - // Formatter interface. - // - // Verb returns the format variant to render, analogous to the types used - // in fmt. Use 'v' for the default or only variant. - // Verb() rune - - // TODO: more info: - // - sentence context such as linguistic features passed by the translator. -} - -// Formatter is analogous to fmt.Formatter. -type Formatter interface { - Format(state State, verb rune) -} diff --git a/vendor/golang.org/x/text/internal/format/parser.go b/vendor/golang.org/x/text/internal/format/parser.go deleted file mode 100644 index 855aed7..0000000 --- a/vendor/golang.org/x/text/internal/format/parser.go +++ /dev/null @@ -1,358 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package format - -import ( - "reflect" - "unicode/utf8" -) - -// A Parser parses a format string. The result from the parse are set in the -// struct fields. -type Parser struct { - Verb rune - - WidthPresent bool - PrecPresent bool - Minus bool - Plus bool - Sharp bool - Space bool - Zero bool - - // For the formats %+v %#v, we set the plusV/sharpV flags - // and clear the plus/sharp flags since %+v and %#v are in effect - // different, flagless formats set at the top level. - PlusV bool - SharpV bool - - HasIndex bool - - Width int - Prec int // precision - - // retain arguments across calls. - Args []interface{} - // retain current argument number across calls - ArgNum int - - // reordered records whether the format string used argument reordering. - Reordered bool - // goodArgNum records whether the most recent reordering directive was valid. - goodArgNum bool - - // position info - format string - startPos int - endPos int - Status Status -} - -// Reset initializes a parser to scan format strings for the given args. -func (p *Parser) Reset(args []interface{}) { - p.Args = args - p.ArgNum = 0 - p.startPos = 0 - p.Reordered = false -} - -// Text returns the part of the format string that was parsed by the last call -// to Scan. It returns the original substitution clause if the current scan -// parsed a substitution. -func (p *Parser) Text() string { return p.format[p.startPos:p.endPos] } - -// SetFormat sets a new format string to parse. It does not reset the argument -// count. -func (p *Parser) SetFormat(format string) { - p.format = format - p.startPos = 0 - p.endPos = 0 -} - -// Status indicates the result type of a call to Scan. -type Status int - -const ( - StatusText Status = iota - StatusSubstitution - StatusBadWidthSubstitution - StatusBadPrecSubstitution - StatusNoVerb - StatusBadArgNum - StatusMissingArg -) - -// ClearFlags reset the parser to default behavior. -func (p *Parser) ClearFlags() { - p.WidthPresent = false - p.PrecPresent = false - p.Minus = false - p.Plus = false - p.Sharp = false - p.Space = false - p.Zero = false - - p.PlusV = false - p.SharpV = false - - p.HasIndex = false -} - -// Scan scans the next part of the format string and sets the status to -// indicate whether it scanned a string literal, substitution or error. -func (p *Parser) Scan() bool { - p.Status = StatusText - format := p.format - end := len(format) - if p.endPos >= end { - return false - } - afterIndex := false // previous item in format was an index like [3]. - - p.startPos = p.endPos - p.goodArgNum = true - i := p.startPos - for i < end && format[i] != '%' { - i++ - } - if i > p.startPos { - p.endPos = i - return true - } - // Process one verb - i++ - - p.Status = StatusSubstitution - - // Do we have flags? - p.ClearFlags() - -simpleFormat: - for ; i < end; i++ { - c := p.format[i] - switch c { - case '#': - p.Sharp = true - case '0': - p.Zero = !p.Minus // Only allow zero padding to the left. - case '+': - p.Plus = true - case '-': - p.Minus = true - p.Zero = false // Do not pad with zeros to the right. - case ' ': - p.Space = true - default: - // Fast path for common case of ascii lower case simple verbs - // without precision or width or argument indices. - if 'a' <= c && c <= 'z' && p.ArgNum < len(p.Args) { - if c == 'v' { - // Go syntax - p.SharpV = p.Sharp - p.Sharp = false - // Struct-field syntax - p.PlusV = p.Plus - p.Plus = false - } - p.Verb = rune(c) - p.ArgNum++ - p.endPos = i + 1 - return true - } - // Format is more complex than simple flags and a verb or is malformed. - break simpleFormat - } - } - - // Do we have an explicit argument index? - i, afterIndex = p.updateArgNumber(format, i) - - // Do we have width? - if i < end && format[i] == '*' { - i++ - p.Width, p.WidthPresent = p.intFromArg() - - if !p.WidthPresent { - p.Status = StatusBadWidthSubstitution - } - - // We have a negative width, so take its value and ensure - // that the minus flag is set - if p.Width < 0 { - p.Width = -p.Width - p.Minus = true - p.Zero = false // Do not pad with zeros to the right. - } - afterIndex = false - } else { - p.Width, p.WidthPresent, i = parsenum(format, i, end) - if afterIndex && p.WidthPresent { // "%[3]2d" - p.goodArgNum = false - } - } - - // Do we have precision? - if i+1 < end && format[i] == '.' { - i++ - if afterIndex { // "%[3].2d" - p.goodArgNum = false - } - i, afterIndex = p.updateArgNumber(format, i) - if i < end && format[i] == '*' { - i++ - p.Prec, p.PrecPresent = p.intFromArg() - // Negative precision arguments don't make sense - if p.Prec < 0 { - p.Prec = 0 - p.PrecPresent = false - } - if !p.PrecPresent { - p.Status = StatusBadPrecSubstitution - } - afterIndex = false - } else { - p.Prec, p.PrecPresent, i = parsenum(format, i, end) - if !p.PrecPresent { - p.Prec = 0 - p.PrecPresent = true - } - } - } - - if !afterIndex { - i, afterIndex = p.updateArgNumber(format, i) - } - p.HasIndex = afterIndex - - if i >= end { - p.endPos = i - p.Status = StatusNoVerb - return true - } - - verb, w := utf8.DecodeRuneInString(format[i:]) - p.endPos = i + w - p.Verb = verb - - switch { - case verb == '%': // Percent does not absorb operands and ignores f.wid and f.prec. - p.startPos = p.endPos - 1 - p.Status = StatusText - case !p.goodArgNum: - p.Status = StatusBadArgNum - case p.ArgNum >= len(p.Args): // No argument left over to print for the current verb. - p.Status = StatusMissingArg - p.ArgNum++ - case verb == 'v': - // Go syntax - p.SharpV = p.Sharp - p.Sharp = false - // Struct-field syntax - p.PlusV = p.Plus - p.Plus = false - fallthrough - default: - p.ArgNum++ - } - return true -} - -// intFromArg gets the ArgNumth element of Args. On return, isInt reports -// whether the argument has integer type. -func (p *Parser) intFromArg() (num int, isInt bool) { - if p.ArgNum < len(p.Args) { - arg := p.Args[p.ArgNum] - num, isInt = arg.(int) // Almost always OK. - if !isInt { - // Work harder. - switch v := reflect.ValueOf(arg); v.Kind() { - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - n := v.Int() - if int64(int(n)) == n { - num = int(n) - isInt = true - } - case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: - n := v.Uint() - if int64(n) >= 0 && uint64(int(n)) == n { - num = int(n) - isInt = true - } - default: - // Already 0, false. - } - } - p.ArgNum++ - if tooLarge(num) { - num = 0 - isInt = false - } - } - return -} - -// parseArgNumber returns the value of the bracketed number, minus 1 -// (explicit argument numbers are one-indexed but we want zero-indexed). -// The opening bracket is known to be present at format[0]. -// The returned values are the index, the number of bytes to consume -// up to the closing paren, if present, and whether the number parsed -// ok. The bytes to consume will be 1 if no closing paren is present. -func parseArgNumber(format string) (index int, wid int, ok bool) { - // There must be at least 3 bytes: [n]. - if len(format) < 3 { - return 0, 1, false - } - - // Find closing bracket. - for i := 1; i < len(format); i++ { - if format[i] == ']' { - width, ok, newi := parsenum(format, 1, i) - if !ok || newi != i { - return 0, i + 1, false - } - return width - 1, i + 1, true // arg numbers are one-indexed and skip paren. - } - } - return 0, 1, false -} - -// updateArgNumber returns the next argument to evaluate, which is either the value of the passed-in -// argNum or the value of the bracketed integer that begins format[i:]. It also returns -// the new value of i, that is, the index of the next byte of the format to process. -func (p *Parser) updateArgNumber(format string, i int) (newi int, found bool) { - if len(format) <= i || format[i] != '[' { - return i, false - } - p.Reordered = true - index, wid, ok := parseArgNumber(format[i:]) - if ok && 0 <= index && index < len(p.Args) { - p.ArgNum = index - return i + wid, true - } - p.goodArgNum = false - return i + wid, ok -} - -// tooLarge reports whether the magnitude of the integer is -// too large to be used as a formatting width or precision. -func tooLarge(x int) bool { - const max int = 1e6 - return x > max || x < -max -} - -// parsenum converts ASCII to integer. num is 0 (and isnum is false) if no number present. -func parsenum(s string, start, end int) (num int, isnum bool, newi int) { - if start >= end { - return 0, false, end - } - for newi = start; newi < end && '0' <= s[newi] && s[newi] <= '9'; newi++ { - if tooLarge(num) { - return 0, false, end // Overflow; crazy long number most likely. - } - num = num*10 + int(s[newi]-'0') - isnum = true - } - return -} diff --git a/vendor/golang.org/x/text/internal/gen/code.go b/vendor/golang.org/x/text/internal/gen/code.go deleted file mode 100644 index 75435c9..0000000 --- a/vendor/golang.org/x/text/internal/gen/code.go +++ /dev/null @@ -1,375 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package gen - -import ( - "bytes" - "encoding/gob" - "fmt" - "hash" - "hash/fnv" - "io" - "log" - "os" - "reflect" - "strings" - "unicode" - "unicode/utf8" -) - -// This file contains utilities for generating code. - -// TODO: other write methods like: -// - slices, maps, types, etc. - -// CodeWriter is a utility for writing structured code. It computes the content -// hash and size of written content. It ensures there are newlines between -// written code blocks. -type CodeWriter struct { - buf bytes.Buffer - Size int - Hash hash.Hash32 // content hash - gob *gob.Encoder - // For comments we skip the usual one-line separator if they are followed by - // a code block. - skipSep bool -} - -func (w *CodeWriter) Write(p []byte) (n int, err error) { - return w.buf.Write(p) -} - -// NewCodeWriter returns a new CodeWriter. -func NewCodeWriter() *CodeWriter { - h := fnv.New32() - return &CodeWriter{Hash: h, gob: gob.NewEncoder(h)} -} - -// WriteGoFile appends the buffer with the total size of all created structures -// and writes it as a Go file to the given file with the given package name. -func (w *CodeWriter) WriteGoFile(filename, pkg string) { - f, err := os.Create(filename) - if err != nil { - log.Fatalf("Could not create file %s: %v", filename, err) - } - defer f.Close() - if _, err = w.WriteGo(f, pkg, ""); err != nil { - log.Fatalf("Error writing file %s: %v", filename, err) - } -} - -// WriteVersionedGoFile appends the buffer with the total size of all created -// structures and writes it as a Go file to the given file with the given -// package name and build tags for the current Unicode version, -func (w *CodeWriter) WriteVersionedGoFile(filename, pkg string) { - tags := buildTags() - if tags != "" { - pattern := fileToPattern(filename) - updateBuildTags(pattern) - filename = fmt.Sprintf(pattern, UnicodeVersion()) - } - f, err := os.Create(filename) - if err != nil { - log.Fatalf("Could not create file %s: %v", filename, err) - } - defer f.Close() - if _, err = w.WriteGo(f, pkg, tags); err != nil { - log.Fatalf("Error writing file %s: %v", filename, err) - } -} - -// WriteGo appends the buffer with the total size of all created structures and -// writes it as a Go file to the given writer with the given package name. -func (w *CodeWriter) WriteGo(out io.Writer, pkg, tags string) (n int, err error) { - sz := w.Size - if sz > 0 { - w.WriteComment("Total table size %d bytes (%dKiB); checksum: %X\n", sz, sz/1024, w.Hash.Sum32()) - } - defer w.buf.Reset() - return WriteGo(out, pkg, tags, w.buf.Bytes()) -} - -func (w *CodeWriter) printf(f string, x ...interface{}) { - fmt.Fprintf(w, f, x...) -} - -func (w *CodeWriter) insertSep() { - if w.skipSep { - w.skipSep = false - return - } - // Use at least two newlines to ensure a blank space between the previous - // block. WriteGoFile will remove extraneous newlines. - w.printf("\n\n") -} - -// WriteComment writes a comment block. All line starts are prefixed with "//". -// Initial empty lines are gobbled. The indentation for the first line is -// stripped from consecutive lines. -func (w *CodeWriter) WriteComment(comment string, args ...interface{}) { - s := fmt.Sprintf(comment, args...) - s = strings.Trim(s, "\n") - - // Use at least two newlines to ensure a blank space between the previous - // block. WriteGoFile will remove extraneous newlines. - w.printf("\n\n// ") - w.skipSep = true - - // strip first indent level. - sep := "\n" - for ; len(s) > 0 && (s[0] == '\t' || s[0] == ' '); s = s[1:] { - sep += s[:1] - } - - strings.NewReplacer(sep, "\n// ", "\n", "\n// ").WriteString(w, s) - - w.printf("\n") -} - -func (w *CodeWriter) writeSizeInfo(size int) { - w.printf("// Size: %d bytes\n", size) -} - -// WriteConst writes a constant of the given name and value. -func (w *CodeWriter) WriteConst(name string, x interface{}) { - w.insertSep() - v := reflect.ValueOf(x) - - switch v.Type().Kind() { - case reflect.String: - w.printf("const %s %s = ", name, typeName(x)) - w.WriteString(v.String()) - w.printf("\n") - default: - w.printf("const %s = %#v\n", name, x) - } -} - -// WriteVar writes a variable of the given name and value. -func (w *CodeWriter) WriteVar(name string, x interface{}) { - w.insertSep() - v := reflect.ValueOf(x) - oldSize := w.Size - sz := int(v.Type().Size()) - w.Size += sz - - switch v.Type().Kind() { - case reflect.String: - w.printf("var %s %s = ", name, typeName(x)) - w.WriteString(v.String()) - case reflect.Struct: - w.gob.Encode(x) - fallthrough - case reflect.Slice, reflect.Array: - w.printf("var %s = ", name) - w.writeValue(v) - w.writeSizeInfo(w.Size - oldSize) - default: - w.printf("var %s %s = ", name, typeName(x)) - w.gob.Encode(x) - w.writeValue(v) - w.writeSizeInfo(w.Size - oldSize) - } - w.printf("\n") -} - -func (w *CodeWriter) writeValue(v reflect.Value) { - x := v.Interface() - switch v.Kind() { - case reflect.String: - w.WriteString(v.String()) - case reflect.Array: - // Don't double count: callers of WriteArray count on the size being - // added, so we need to discount it here. - w.Size -= int(v.Type().Size()) - w.writeSlice(x, true) - case reflect.Slice: - w.writeSlice(x, false) - case reflect.Struct: - w.printf("%s{\n", typeName(v.Interface())) - t := v.Type() - for i := 0; i < v.NumField(); i++ { - w.printf("%s: ", t.Field(i).Name) - w.writeValue(v.Field(i)) - w.printf(",\n") - } - w.printf("}") - default: - w.printf("%#v", x) - } -} - -// WriteString writes a string literal. -func (w *CodeWriter) WriteString(s string) { - io.WriteString(w.Hash, s) // content hash - w.Size += len(s) - - const maxInline = 40 - if len(s) <= maxInline { - w.printf("%q", s) - return - } - - // We will render the string as a multi-line string. - const maxWidth = 80 - 4 - len(`"`) - len(`" +`) - - // When starting on its own line, go fmt indents line 2+ an extra level. - n, max := maxWidth, maxWidth-4 - - // As per https://golang.org/issue/18078, the compiler has trouble - // compiling the concatenation of many strings, s0 + s1 + s2 + ... + sN, - // for large N. We insert redundant, explicit parentheses to work around - // that, lowering the N at any given step: (s0 + s1 + ... + s63) + (s64 + - // ... + s127) + etc + (etc + ... + sN). - explicitParens, extraComment := len(s) > 128*1024, "" - if explicitParens { - w.printf(`(`) - extraComment = "; the redundant, explicit parens are for https://golang.org/issue/18078" - } - - // Print "" +\n, if a string does not start on its own line. - b := w.buf.Bytes() - if p := len(bytes.TrimRight(b, " \t")); p > 0 && b[p-1] != '\n' { - w.printf("\"\" + // Size: %d bytes%s\n", len(s), extraComment) - n, max = maxWidth, maxWidth - } - - w.printf(`"`) - - for sz, p, nLines := 0, 0, 0; p < len(s); { - var r rune - r, sz = utf8.DecodeRuneInString(s[p:]) - out := s[p : p+sz] - chars := 1 - if !unicode.IsPrint(r) || r == utf8.RuneError || r == '"' { - switch sz { - case 1: - out = fmt.Sprintf("\\x%02x", s[p]) - case 2, 3: - out = fmt.Sprintf("\\u%04x", r) - case 4: - out = fmt.Sprintf("\\U%08x", r) - } - chars = len(out) - } else if r == '\\' { - out = "\\" + string(r) - chars = 2 - } - if n -= chars; n < 0 { - nLines++ - if explicitParens && nLines&63 == 63 { - w.printf("\") + (\"") - } - w.printf("\" +\n\"") - n = max - len(out) - } - w.printf("%s", out) - p += sz - } - w.printf(`"`) - if explicitParens { - w.printf(`)`) - } -} - -// WriteSlice writes a slice value. -func (w *CodeWriter) WriteSlice(x interface{}) { - w.writeSlice(x, false) -} - -// WriteArray writes an array value. -func (w *CodeWriter) WriteArray(x interface{}) { - w.writeSlice(x, true) -} - -func (w *CodeWriter) writeSlice(x interface{}, isArray bool) { - v := reflect.ValueOf(x) - w.gob.Encode(v.Len()) - w.Size += v.Len() * int(v.Type().Elem().Size()) - name := typeName(x) - if isArray { - name = fmt.Sprintf("[%d]%s", v.Len(), name[strings.Index(name, "]")+1:]) - } - if isArray { - w.printf("%s{\n", name) - } else { - w.printf("%s{ // %d elements\n", name, v.Len()) - } - - switch kind := v.Type().Elem().Kind(); kind { - case reflect.String: - for _, s := range x.([]string) { - w.WriteString(s) - w.printf(",\n") - } - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, - reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: - // nLine and nBlock are the number of elements per line and block. - nLine, nBlock, format := 8, 64, "%d," - switch kind { - case reflect.Uint8: - format = "%#02x," - case reflect.Uint16: - format = "%#04x," - case reflect.Uint32: - nLine, nBlock, format = 4, 32, "%#08x," - case reflect.Uint, reflect.Uint64: - nLine, nBlock, format = 4, 32, "%#016x," - case reflect.Int8: - nLine = 16 - } - n := nLine - for i := 0; i < v.Len(); i++ { - if i%nBlock == 0 && v.Len() > nBlock { - w.printf("// Entry %X - %X\n", i, i+nBlock-1) - } - x := v.Index(i).Interface() - w.gob.Encode(x) - w.printf(format, x) - if n--; n == 0 { - n = nLine - w.printf("\n") - } - } - w.printf("\n") - case reflect.Struct: - zero := reflect.Zero(v.Type().Elem()).Interface() - for i := 0; i < v.Len(); i++ { - x := v.Index(i).Interface() - w.gob.EncodeValue(v) - if !reflect.DeepEqual(zero, x) { - line := fmt.Sprintf("%#v,\n", x) - line = line[strings.IndexByte(line, '{'):] - w.printf("%d: ", i) - w.printf(line) - } - } - case reflect.Array: - for i := 0; i < v.Len(); i++ { - w.printf("%d: %#v,\n", i, v.Index(i).Interface()) - } - default: - panic("gen: slice elem type not supported") - } - w.printf("}") -} - -// WriteType writes a definition of the type of the given value and returns the -// type name. -func (w *CodeWriter) WriteType(x interface{}) string { - t := reflect.TypeOf(x) - w.printf("type %s struct {\n", t.Name()) - for i := 0; i < t.NumField(); i++ { - w.printf("\t%s %s\n", t.Field(i).Name, t.Field(i).Type) - } - w.printf("}\n") - return t.Name() -} - -// typeName returns the name of the go type of x. -func typeName(x interface{}) string { - t := reflect.ValueOf(x).Type() - return strings.Replace(fmt.Sprint(t), "main.", "", 1) -} diff --git a/vendor/golang.org/x/text/internal/gen/gen.go b/vendor/golang.org/x/text/internal/gen/gen.go deleted file mode 100644 index 78bfef6..0000000 --- a/vendor/golang.org/x/text/internal/gen/gen.go +++ /dev/null @@ -1,354 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package gen contains common code for the various code generation tools in the -// text repository. Its usage ensures consistency between tools. -// -// This package defines command line flags that are common to most generation -// tools. The flags allow for specifying specific Unicode and CLDR versions -// in the public Unicode data repository (https://www.unicode.org/Public). -// -// A local Unicode data mirror can be set through the flag -local or the -// environment variable UNICODE_DIR. The former takes precedence. The local -// directory should follow the same structure as the public repository. -// -// IANA data can also optionally be mirrored by putting it in the iana directory -// rooted at the top of the local mirror. Beware, though, that IANA data is not -// versioned. So it is up to the developer to use the right version. -package gen // import "golang.org/x/text/internal/gen" - -import ( - "bytes" - "flag" - "fmt" - "go/build" - "go/format" - "io" - "log" - "net/http" - "os" - "path" - "path/filepath" - "regexp" - "strings" - "sync" - "unicode" - - "golang.org/x/text/unicode/cldr" -) - -var ( - url = flag.String("url", - "https://www.unicode.org/Public", - "URL of Unicode database directory") - iana = flag.String("iana", - "http://www.iana.org", - "URL of the IANA repository") - unicodeVersion = flag.String("unicode", - getEnv("UNICODE_VERSION", unicode.Version), - "unicode version to use") - cldrVersion = flag.String("cldr", - getEnv("CLDR_VERSION", cldr.Version), - "cldr version to use") -) - -func getEnv(name, def string) string { - if v := os.Getenv(name); v != "" { - return v - } - return def -} - -// Init performs common initialization for a gen command. It parses the flags -// and sets up the standard logging parameters. -func Init() { - log.SetPrefix("") - log.SetFlags(log.Lshortfile) - flag.Parse() -} - -const header = `// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -` - -// UnicodeVersion reports the requested Unicode version. -func UnicodeVersion() string { - return *unicodeVersion -} - -// CLDRVersion reports the requested CLDR version. -func CLDRVersion() string { - return *cldrVersion -} - -var tags = []struct{ version, buildTags string }{ - {"9.0.0", "!go1.10"}, - {"10.0.0", "go1.10,!go1.13"}, - {"11.0.0", "go1.13,!go1.14"}, - {"12.0.0", "go1.14,!go1.16"}, - {"13.0.0", "go1.16,!go1.21"}, - {"15.0.0", "go1.21"}, -} - -// buildTags reports the build tags used for the current Unicode version. -func buildTags() string { - v := UnicodeVersion() - for _, e := range tags { - if e.version == v { - return e.buildTags - } - } - log.Fatalf("Unknown build tags for Unicode version %q.", v) - return "" -} - -// IsLocal reports whether data files are available locally. -func IsLocal() bool { - dir, err := localReadmeFile() - if err != nil { - return false - } - if _, err = os.Stat(dir); err != nil { - return false - } - return true -} - -// OpenUCDFile opens the requested UCD file. The file is specified relative to -// the public Unicode root directory. It will call log.Fatal if there are any -// errors. -func OpenUCDFile(file string) io.ReadCloser { - return openUnicode(path.Join(*unicodeVersion, "ucd", file)) -} - -// OpenCLDRCoreZip opens the CLDR core zip file. It will call log.Fatal if there -// are any errors. -func OpenCLDRCoreZip() io.ReadCloser { - return OpenUnicodeFile("cldr", *cldrVersion, "core.zip") -} - -// OpenUnicodeFile opens the requested file of the requested category from the -// root of the Unicode data archive. The file is specified relative to the -// public Unicode root directory. If version is "", it will use the default -// Unicode version. It will call log.Fatal if there are any errors. -func OpenUnicodeFile(category, version, file string) io.ReadCloser { - if version == "" { - version = UnicodeVersion() - } - return openUnicode(path.Join(category, version, file)) -} - -// OpenIANAFile opens the requested IANA file. The file is specified relative -// to the IANA root, which is typically either http://www.iana.org or the -// iana directory in the local mirror. It will call log.Fatal if there are any -// errors. -func OpenIANAFile(path string) io.ReadCloser { - return Open(*iana, "iana", path) -} - -var ( - dirMutex sync.Mutex - localDir string -) - -const permissions = 0755 - -func localReadmeFile() (string, error) { - p, err := build.Import("golang.org/x/text", "", build.FindOnly) - if err != nil { - return "", fmt.Errorf("Could not locate package: %v", err) - } - return filepath.Join(p.Dir, "DATA", "README"), nil -} - -func getLocalDir() string { - dirMutex.Lock() - defer dirMutex.Unlock() - - readme, err := localReadmeFile() - if err != nil { - log.Fatal(err) - } - dir := filepath.Dir(readme) - if _, err := os.Stat(readme); err != nil { - if err := os.MkdirAll(dir, permissions); err != nil { - log.Fatalf("Could not create directory: %v", err) - } - os.WriteFile(readme, []byte(readmeTxt), permissions) - } - return dir -} - -const readmeTxt = `Generated by golang.org/x/text/internal/gen. DO NOT EDIT. - -This directory contains downloaded files used to generate the various tables -in the golang.org/x/text subrepo. - -Note that the language subtag repo (iana/assignments/language-subtag-registry) -and all other times in the iana subdirectory are not versioned and will need -to be periodically manually updated. The easiest way to do this is to remove -the entire iana directory. This is mostly of concern when updating the language -package. -` - -// Open opens subdir/path if a local directory is specified and the file exists, -// where subdir is a directory relative to the local root, or fetches it from -// urlRoot/path otherwise. It will call log.Fatal if there are any errors. -func Open(urlRoot, subdir, path string) io.ReadCloser { - file := filepath.Join(getLocalDir(), subdir, filepath.FromSlash(path)) - return open(file, urlRoot, path) -} - -func openUnicode(path string) io.ReadCloser { - file := filepath.Join(getLocalDir(), filepath.FromSlash(path)) - return open(file, *url, path) -} - -// TODO: automatically periodically update non-versioned files. - -func open(file, urlRoot, path string) io.ReadCloser { - if f, err := os.Open(file); err == nil { - return f - } - r := get(urlRoot, path) - defer r.Close() - b, err := io.ReadAll(r) - if err != nil { - log.Fatalf("Could not download file: %v", err) - } - os.MkdirAll(filepath.Dir(file), permissions) - if err := os.WriteFile(file, b, permissions); err != nil { - log.Fatalf("Could not create file: %v", err) - } - return io.NopCloser(bytes.NewReader(b)) -} - -func get(root, path string) io.ReadCloser { - url := root + "/" + path - fmt.Printf("Fetching %s...", url) - defer fmt.Println(" done.") - resp, err := http.Get(url) - if err != nil { - log.Fatalf("HTTP GET: %v", err) - } - if resp.StatusCode != 200 { - log.Fatalf("Bad GET status for %q: %q", url, resp.Status) - } - return resp.Body -} - -// TODO: use Write*Version in all applicable packages. - -// WriteUnicodeVersion writes a constant for the Unicode version from which the -// tables are generated. -func WriteUnicodeVersion(w io.Writer) { - fmt.Fprintf(w, "// UnicodeVersion is the Unicode version from which the tables in this package are derived.\n") - fmt.Fprintf(w, "const UnicodeVersion = %q\n\n", UnicodeVersion()) -} - -// WriteCLDRVersion writes a constant for the CLDR version from which the -// tables are generated. -func WriteCLDRVersion(w io.Writer) { - fmt.Fprintf(w, "// CLDRVersion is the CLDR version from which the tables in this package are derived.\n") - fmt.Fprintf(w, "const CLDRVersion = %q\n\n", CLDRVersion()) -} - -// WriteGoFile prepends a standard file comment and package statement to the -// given bytes, applies gofmt, and writes them to a file with the given name. -// It will call log.Fatal if there are any errors. -func WriteGoFile(filename, pkg string, b []byte) { - w, err := os.Create(filename) - if err != nil { - log.Fatalf("Could not create file %s: %v", filename, err) - } - defer w.Close() - if _, err = WriteGo(w, pkg, "", b); err != nil { - log.Fatalf("Error writing file %s: %v", filename, err) - } -} - -func fileToPattern(filename string) string { - suffix := ".go" - if strings.HasSuffix(filename, "_test.go") { - suffix = "_test.go" - } - prefix := filename[:len(filename)-len(suffix)] - return fmt.Sprint(prefix, "%s", suffix) -} - -// tagLines returns the //go:build lines to add to the file. -func tagLines(tags string) string { - return "//go:build " + strings.ReplaceAll(tags, ",", " && ") + "\n" -} - -func updateBuildTags(pattern string) { - for _, t := range tags { - oldFile := fmt.Sprintf(pattern, t.version) - b, err := os.ReadFile(oldFile) - if err != nil { - continue - } - b = regexp.MustCompile(`//go:build.*\n`).ReplaceAll(b, []byte(tagLines(t.buildTags))) - err = os.WriteFile(oldFile, b, 0644) - if err != nil { - log.Fatal(err) - } - } -} - -// WriteVersionedGoFile prepends a standard file comment, adds build tags to -// version the file for the current Unicode version, and package statement to -// the given bytes, applies gofmt, and writes them to a file with the given -// name. It will call log.Fatal if there are any errors. -func WriteVersionedGoFile(filename, pkg string, b []byte) { - pattern := fileToPattern(filename) - updateBuildTags(pattern) - filename = fmt.Sprintf(pattern, UnicodeVersion()) - - w, err := os.Create(filename) - if err != nil { - log.Fatalf("Could not create file %s: %v", filename, err) - } - defer w.Close() - if _, err = WriteGo(w, pkg, buildTags(), b); err != nil { - log.Fatalf("Error writing file %s: %v", filename, err) - } -} - -// WriteGo prepends a standard file comment and package statement to the given -// bytes, applies gofmt, and writes them to w. -func WriteGo(w io.Writer, pkg, tags string, b []byte) (n int, err error) { - src := []byte(header) - if tags != "" { - src = append(src, tagLines(tags)...) - src = append(src, '\n') - } - src = append(src, fmt.Sprintf("package %s\n\n", pkg)...) - src = append(src, b...) - formatted, err := format.Source(src) - if err != nil { - // Print the generated code even in case of an error so that the - // returned error can be meaningfully interpreted. - n, _ = w.Write(src) - return n, err - } - return w.Write(formatted) -} - -// Repackage rewrites a Go file from belonging to package main to belonging to -// the given package. -func Repackage(inFile, outFile, pkg string) { - src, err := os.ReadFile(inFile) - if err != nil { - log.Fatalf("reading %s: %v", inFile, err) - } - const toDelete = "package main\n\n" - i := bytes.Index(src, []byte(toDelete)) - if i < 0 { - log.Fatalf("Could not find %q in %s.", toDelete, inFile) - } - w := &bytes.Buffer{} - w.Write(src[i+len(toDelete):]) - WriteGoFile(outFile, pkg, w.Bytes()) -} diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go deleted file mode 100644 index 3cddbbd..0000000 --- a/vendor/golang.org/x/text/internal/internal.go +++ /dev/null @@ -1,49 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package internal contains non-exported functionality that are used by -// packages in the text repository. -package internal // import "golang.org/x/text/internal" - -import ( - "sort" - - "golang.org/x/text/language" -) - -// SortTags sorts tags in place. -func SortTags(tags []language.Tag) { - sort.Sort(sorter(tags)) -} - -type sorter []language.Tag - -func (s sorter) Len() int { - return len(s) -} - -func (s sorter) Swap(i, j int) { - s[i], s[j] = s[j], s[i] -} - -func (s sorter) Less(i, j int) bool { - return s[i].String() < s[j].String() -} - -// UniqueTags sorts and filters duplicate tags in place and returns a slice with -// only unique tags. -func UniqueTags(tags []language.Tag) []language.Tag { - if len(tags) <= 1 { - return tags - } - SortTags(tags) - k := 0 - for i := 1; i < len(tags); i++ { - if tags[k].String() < tags[i].String() { - k++ - tags[k] = tags[i] - } - } - return tags[:k+1] -} diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go deleted file mode 100644 index cdfdb74..0000000 --- a/vendor/golang.org/x/text/internal/language/common.go +++ /dev/null @@ -1,16 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// This file contains code common to the maketables.go and the package code. - -// AliasType is the type of an alias in AliasMap. -type AliasType int8 - -const ( - Deprecated AliasType = iota - Macro - Legacy - - AliasTypeUnknown AliasType = -1 -) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go deleted file mode 100644 index 46a0015..0000000 --- a/vendor/golang.org/x/text/internal/language/compact.go +++ /dev/null @@ -1,29 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// CompactCoreInfo is a compact integer with the three core tags encoded. -type CompactCoreInfo uint32 - -// GetCompactCore generates a uint32 value that is guaranteed to be unique for -// different language, region, and script values. -func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { - if t.LangID > langNoIndexOffset { - return 0, false - } - cci |= CompactCoreInfo(t.LangID) << (8 + 12) - cci |= CompactCoreInfo(t.ScriptID) << 12 - cci |= CompactCoreInfo(t.RegionID) - return cci, true -} - -// Tag generates a tag from c. -func (c CompactCoreInfo) Tag() Tag { - return Tag{ - LangID: Language(c >> 20), - RegionID: Region(c & 0x3ff), - ScriptID: Script(c>>12) & 0xff, - } -} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go deleted file mode 100644 index 1b36935..0000000 --- a/vendor/golang.org/x/text/internal/language/compact/compact.go +++ /dev/null @@ -1,61 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package compact defines a compact representation of language tags. -// -// Common language tags (at least all for which locale information is defined -// in CLDR) are assigned a unique index. Each Tag is associated with such an -// ID for selecting language-related resources (such as translations) as well -// as one for selecting regional defaults (currency, number formatting, etc.) -// -// It may want to export this functionality at some point, but at this point -// this is only available for use within x/text. -package compact // import "golang.org/x/text/internal/language/compact" - -import ( - "sort" - "strings" - - "golang.org/x/text/internal/language" -) - -// ID is an integer identifying a single tag. -type ID uint16 - -func getCoreIndex(t language.Tag) (id ID, ok bool) { - cci, ok := language.GetCompactCore(t) - if !ok { - return 0, false - } - i := sort.Search(len(coreTags), func(i int) bool { - return cci <= coreTags[i] - }) - if i == len(coreTags) || coreTags[i] != cci { - return 0, false - } - return ID(i), true -} - -// Parent returns the ID of the parent or the root ID if id is already the root. -func (id ID) Parent() ID { - return parents[id] -} - -// Tag converts id to an internal language Tag. -func (id ID) Tag() language.Tag { - if int(id) >= len(coreTags) { - return specialTags[int(id)-len(coreTags)] - } - return coreTags[id].Tag() -} - -var specialTags []language.Tag - -func init() { - tags := strings.Split(specialTagsStr, " ") - specialTags = make([]language.Tag, len(tags)) - for i, t := range tags { - specialTags[i] = language.MustParse(t) - } -} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go deleted file mode 100644 index 8c1b666..0000000 --- a/vendor/golang.org/x/text/internal/language/compact/language.go +++ /dev/null @@ -1,260 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_index.go -output tables.go -//go:generate go run gen_parents.go - -package compact - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "strings" - - "golang.org/x/text/internal/language" -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. -type Tag struct { - // NOTE: exported tags will become part of the public API. - language ID - locale ID - full fullTag // always a language.Tag for now. -} - -const _und = 0 - -type fullTag interface { - IsRoot() bool - Parent() language.Tag -} - -// Make a compact Tag from a fully specified internal language Tag. -func Make(t language.Tag) (tag Tag) { - if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { - if r, err := language.ParseRegion(region[:2]); err == nil { - tFull := t - t, _ = t.SetTypeForKey("rg", "") - // TODO: should we not consider "va" for the language tag? - var exact1, exact2 bool - tag.language, exact1 = FromTag(t) - t.RegionID = r - tag.locale, exact2 = FromTag(t) - if !exact1 || !exact2 { - tag.full = tFull - } - return tag - } - } - lang, ok := FromTag(t) - tag.language = lang - tag.locale = lang - if !ok { - tag.full = t - } - return tag -} - -// Tag returns an internal language Tag version of this tag. -func (t Tag) Tag() language.Tag { - if t.full != nil { - return t.full.(language.Tag) - } - tag := t.language.Tag() - if t.language != t.locale { - loc := t.locale.Tag() - tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") - } - return tag -} - -// IsCompact reports whether this tag is fully defined in terms of ID. -func (t *Tag) IsCompact() bool { - return t.full == nil -} - -// MayHaveVariants reports whether a tag may have variants. If it returns false -// it is guaranteed the tag does not have variants. -func (t Tag) MayHaveVariants() bool { - return t.full != nil || int(t.language) >= len(coreTags) -} - -// MayHaveExtensions reports whether a tag may have extensions. If it returns -// false it is guaranteed the tag does not have them. -func (t Tag) MayHaveExtensions() bool { - return t.full != nil || - int(t.language) >= len(coreTags) || - t.language != t.locale -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - if t.full != nil { - return t.full.IsRoot() - } - return t.language == _und -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -func (t Tag) Parent() Tag { - if t.full != nil { - return Make(t.full.Parent()) - } - if t.language != t.locale { - // Simulate stripping -u-rg-xxxxxx - return Tag{language: t.language, locale: t.language} - } - // TODO: use parent lookup table once cycle from internal package is - // removed. Probably by internalizing the table and declaring this fast - // enough. - // lang := compactID(internal.Parent(uint16(t.language))) - lang, _ := FromTag(t.language.Tag().Parent()) - return Tag{language: lang, locale: lang} -} - -// nextToken returns token t and the rest of the string. -func nextToken(s string) (t, tail string) { - p := strings.Index(s[1:], "-") - if p == -1 { - return s[1:], "" - } - p++ - return s[1:p], s[p:] -} - -// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository.The index will change over time -// and should not be stored in persistent storage. If t does not match a compact -// index, exact will be false and the compact index will be returned for the -// first match after repeatedly taking the Parent of t. -func LanguageID(t Tag) (id ID, exact bool) { - return t.language, t.full == nil -} - -// RegionalID returns the ID for the regional variant of this tag. This index is -// used to indicate region-specific overrides, such as default currency, default -// calendar and week data, default time cycle, and default measurement system -// and unit preferences. -// -// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US -// settings for currency, number formatting, etc. The CompactIndex for this tag -// will be that for en-GB, while the RegionalID will be the one corresponding to -// en-US. -func RegionalID(t Tag) (id ID, exact bool) { - return t.locale, t.full == nil -} - -// LanguageTag returns t stripped of regional variant indicators. -// -// At the moment this means it is stripped of a regional and variant subtag "rg" -// and "va" in the "u" extension. -func (t Tag) LanguageTag() Tag { - if t.full == nil { - return Tag{language: t.language, locale: t.language} - } - tt := t.Tag() - tt.SetTypeForKey("rg", "") - tt.SetTypeForKey("va", "") - return Make(tt) -} - -// RegionalTag returns the regional variant of the tag. -// -// At the moment this means that the region is set from the regional subtag -// "rg" in the "u" extension. -func (t Tag) RegionalTag() Tag { - rt := Tag{language: t.locale, locale: t.locale} - if t.full == nil { - return rt - } - b := language.Builder{} - tag := t.Tag() - // tag, _ = tag.SetTypeForKey("rg", "") - b.SetTag(t.locale.Tag()) - if v := tag.Variants(); v != "" { - for _, v := range strings.Split(v, "-") { - b.AddVariant(v) - } - } - for _, e := range tag.Extensions() { - b.AddExt(e) - } - return t -} - -// FromTag reports closest matching ID for an internal language Tag. -func FromTag(t language.Tag) (id ID, exact bool) { - // TODO: perhaps give more frequent tags a lower index. - // TODO: we could make the indexes stable. This will excluded some - // possibilities for optimization, so don't do this quite yet. - exact = true - - b, s, r := t.Raw() - if t.HasString() { - if t.IsPrivateUse() { - // We have no entries for user-defined tags. - return 0, false - } - hasExtra := false - if t.HasVariants() { - if t.HasExtensions() { - build := language.Builder{} - build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) - build.AddVariant(t.Variants()) - exact = false - t = build.Make() - } - hasExtra = true - } else if _, ok := t.Extension('u'); ok { - // TODO: va may mean something else. Consider not considering it. - // Strip all but the 'va' entry. - old := t - variant := t.TypeForKey("va") - t = language.Tag{LangID: b, ScriptID: s, RegionID: r} - if variant != "" { - t, _ = t.SetTypeForKey("va", variant) - hasExtra = true - } - exact = old == t - } else { - exact = false - } - if hasExtra { - // We have some variants. - for i, s := range specialTags { - if s == t { - return ID(i + len(coreTags)), exact - } - } - exact = false - } - } - if x, ok := getCoreIndex(t); ok { - return x, exact - } - exact = false - if r != 0 && s == 0 { - // Deal with cases where an extra script is inserted for the region. - t, _ := t.Maximize() - if x, ok := getCoreIndex(t); ok { - return x, exact - } - } - for t = t.Parent(); t != root; t = t.Parent() { - // No variants specified: just compare core components. - // The key has the form lllssrrr, where l, s, and r are nibbles for - // respectively the langID, scriptID, and regionID. - if x, ok := getCoreIndex(t); ok { - return x, exact - } - } - return 0, exact -} - -var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go deleted file mode 100644 index 8d81072..0000000 --- a/vendor/golang.org/x/text/internal/language/compact/parents.go +++ /dev/null @@ -1,120 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package compact - -// parents maps a compact index of a tag to the compact index of the parent of -// this tag. -var parents = []ID{ // 775 elements - // Entry 0 - 3F - 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, - 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, - 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, - 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, - 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, - // Entry 40 - 7F - 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, - 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, - 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, - 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, - 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, - 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, - 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, - 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, - // Entry 80 - BF - 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, - 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, - 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, - 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, - // Entry C0 - FF - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, - 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, - 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, - 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, - 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, - // Entry 100 - 13F - 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, - 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, - 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, - 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, - 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - // Entry 140 - 17F - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, - 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, - 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, - 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, - 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, - 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, - // Entry 180 - 1BF - 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, - 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, - 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, - 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, - 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, - 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, - 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, - 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, - // Entry 1C0 - 1FF - 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, - 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, - 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, - 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, - 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, - 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, - 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, - 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, - // Entry 200 - 23F - 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, - 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, - 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, - 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, - 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, - 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, - 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, - // Entry 240 - 27F - 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, - 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, - 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, - 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, - 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, - 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, - 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, - 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, - // Entry 280 - 2BF - 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, - 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, - 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, - 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, - 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, - 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, - 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, - 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, - // Entry 2C0 - 2FF - 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, - 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, - 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, - 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, - 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, - 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, - 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, - 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, - // Entry 300 - 33F - 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, -} // Size: 1574 bytes - -// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go deleted file mode 100644 index a09ed19..0000000 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ /dev/null @@ -1,1015 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package compact - -import "golang.org/x/text/internal/language" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -// NumCompactTags is the number of common tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = 775 -const ( - undIndex ID = 0 - afIndex ID = 1 - afNAIndex ID = 2 - afZAIndex ID = 3 - agqIndex ID = 4 - agqCMIndex ID = 5 - akIndex ID = 6 - akGHIndex ID = 7 - amIndex ID = 8 - amETIndex ID = 9 - arIndex ID = 10 - ar001Index ID = 11 - arAEIndex ID = 12 - arBHIndex ID = 13 - arDJIndex ID = 14 - arDZIndex ID = 15 - arEGIndex ID = 16 - arEHIndex ID = 17 - arERIndex ID = 18 - arILIndex ID = 19 - arIQIndex ID = 20 - arJOIndex ID = 21 - arKMIndex ID = 22 - arKWIndex ID = 23 - arLBIndex ID = 24 - arLYIndex ID = 25 - arMAIndex ID = 26 - arMRIndex ID = 27 - arOMIndex ID = 28 - arPSIndex ID = 29 - arQAIndex ID = 30 - arSAIndex ID = 31 - arSDIndex ID = 32 - arSOIndex ID = 33 - arSSIndex ID = 34 - arSYIndex ID = 35 - arTDIndex ID = 36 - arTNIndex ID = 37 - arYEIndex ID = 38 - arsIndex ID = 39 - asIndex ID = 40 - asINIndex ID = 41 - asaIndex ID = 42 - asaTZIndex ID = 43 - astIndex ID = 44 - astESIndex ID = 45 - azIndex ID = 46 - azCyrlIndex ID = 47 - azCyrlAZIndex ID = 48 - azLatnIndex ID = 49 - azLatnAZIndex ID = 50 - basIndex ID = 51 - basCMIndex ID = 52 - beIndex ID = 53 - beBYIndex ID = 54 - bemIndex ID = 55 - bemZMIndex ID = 56 - bezIndex ID = 57 - bezTZIndex ID = 58 - bgIndex ID = 59 - bgBGIndex ID = 60 - bhIndex ID = 61 - bmIndex ID = 62 - bmMLIndex ID = 63 - bnIndex ID = 64 - bnBDIndex ID = 65 - bnINIndex ID = 66 - boIndex ID = 67 - boCNIndex ID = 68 - boINIndex ID = 69 - brIndex ID = 70 - brFRIndex ID = 71 - brxIndex ID = 72 - brxINIndex ID = 73 - bsIndex ID = 74 - bsCyrlIndex ID = 75 - bsCyrlBAIndex ID = 76 - bsLatnIndex ID = 77 - bsLatnBAIndex ID = 78 - caIndex ID = 79 - caADIndex ID = 80 - caESIndex ID = 81 - caFRIndex ID = 82 - caITIndex ID = 83 - ccpIndex ID = 84 - ccpBDIndex ID = 85 - ccpINIndex ID = 86 - ceIndex ID = 87 - ceRUIndex ID = 88 - cggIndex ID = 89 - cggUGIndex ID = 90 - chrIndex ID = 91 - chrUSIndex ID = 92 - ckbIndex ID = 93 - ckbIQIndex ID = 94 - ckbIRIndex ID = 95 - csIndex ID = 96 - csCZIndex ID = 97 - cuIndex ID = 98 - cuRUIndex ID = 99 - cyIndex ID = 100 - cyGBIndex ID = 101 - daIndex ID = 102 - daDKIndex ID = 103 - daGLIndex ID = 104 - davIndex ID = 105 - davKEIndex ID = 106 - deIndex ID = 107 - deATIndex ID = 108 - deBEIndex ID = 109 - deCHIndex ID = 110 - deDEIndex ID = 111 - deITIndex ID = 112 - deLIIndex ID = 113 - deLUIndex ID = 114 - djeIndex ID = 115 - djeNEIndex ID = 116 - dsbIndex ID = 117 - dsbDEIndex ID = 118 - duaIndex ID = 119 - duaCMIndex ID = 120 - dvIndex ID = 121 - dyoIndex ID = 122 - dyoSNIndex ID = 123 - dzIndex ID = 124 - dzBTIndex ID = 125 - ebuIndex ID = 126 - ebuKEIndex ID = 127 - eeIndex ID = 128 - eeGHIndex ID = 129 - eeTGIndex ID = 130 - elIndex ID = 131 - elCYIndex ID = 132 - elGRIndex ID = 133 - enIndex ID = 134 - en001Index ID = 135 - en150Index ID = 136 - enAGIndex ID = 137 - enAIIndex ID = 138 - enASIndex ID = 139 - enATIndex ID = 140 - enAUIndex ID = 141 - enBBIndex ID = 142 - enBEIndex ID = 143 - enBIIndex ID = 144 - enBMIndex ID = 145 - enBSIndex ID = 146 - enBWIndex ID = 147 - enBZIndex ID = 148 - enCAIndex ID = 149 - enCCIndex ID = 150 - enCHIndex ID = 151 - enCKIndex ID = 152 - enCMIndex ID = 153 - enCXIndex ID = 154 - enCYIndex ID = 155 - enDEIndex ID = 156 - enDGIndex ID = 157 - enDKIndex ID = 158 - enDMIndex ID = 159 - enERIndex ID = 160 - enFIIndex ID = 161 - enFJIndex ID = 162 - enFKIndex ID = 163 - enFMIndex ID = 164 - enGBIndex ID = 165 - enGDIndex ID = 166 - enGGIndex ID = 167 - enGHIndex ID = 168 - enGIIndex ID = 169 - enGMIndex ID = 170 - enGUIndex ID = 171 - enGYIndex ID = 172 - enHKIndex ID = 173 - enIEIndex ID = 174 - enILIndex ID = 175 - enIMIndex ID = 176 - enINIndex ID = 177 - enIOIndex ID = 178 - enJEIndex ID = 179 - enJMIndex ID = 180 - enKEIndex ID = 181 - enKIIndex ID = 182 - enKNIndex ID = 183 - enKYIndex ID = 184 - enLCIndex ID = 185 - enLRIndex ID = 186 - enLSIndex ID = 187 - enMGIndex ID = 188 - enMHIndex ID = 189 - enMOIndex ID = 190 - enMPIndex ID = 191 - enMSIndex ID = 192 - enMTIndex ID = 193 - enMUIndex ID = 194 - enMWIndex ID = 195 - enMYIndex ID = 196 - enNAIndex ID = 197 - enNFIndex ID = 198 - enNGIndex ID = 199 - enNLIndex ID = 200 - enNRIndex ID = 201 - enNUIndex ID = 202 - enNZIndex ID = 203 - enPGIndex ID = 204 - enPHIndex ID = 205 - enPKIndex ID = 206 - enPNIndex ID = 207 - enPRIndex ID = 208 - enPWIndex ID = 209 - enRWIndex ID = 210 - enSBIndex ID = 211 - enSCIndex ID = 212 - enSDIndex ID = 213 - enSEIndex ID = 214 - enSGIndex ID = 215 - enSHIndex ID = 216 - enSIIndex ID = 217 - enSLIndex ID = 218 - enSSIndex ID = 219 - enSXIndex ID = 220 - enSZIndex ID = 221 - enTCIndex ID = 222 - enTKIndex ID = 223 - enTOIndex ID = 224 - enTTIndex ID = 225 - enTVIndex ID = 226 - enTZIndex ID = 227 - enUGIndex ID = 228 - enUMIndex ID = 229 - enUSIndex ID = 230 - enVCIndex ID = 231 - enVGIndex ID = 232 - enVIIndex ID = 233 - enVUIndex ID = 234 - enWSIndex ID = 235 - enZAIndex ID = 236 - enZMIndex ID = 237 - enZWIndex ID = 238 - eoIndex ID = 239 - eo001Index ID = 240 - esIndex ID = 241 - es419Index ID = 242 - esARIndex ID = 243 - esBOIndex ID = 244 - esBRIndex ID = 245 - esBZIndex ID = 246 - esCLIndex ID = 247 - esCOIndex ID = 248 - esCRIndex ID = 249 - esCUIndex ID = 250 - esDOIndex ID = 251 - esEAIndex ID = 252 - esECIndex ID = 253 - esESIndex ID = 254 - esGQIndex ID = 255 - esGTIndex ID = 256 - esHNIndex ID = 257 - esICIndex ID = 258 - esMXIndex ID = 259 - esNIIndex ID = 260 - esPAIndex ID = 261 - esPEIndex ID = 262 - esPHIndex ID = 263 - esPRIndex ID = 264 - esPYIndex ID = 265 - esSVIndex ID = 266 - esUSIndex ID = 267 - esUYIndex ID = 268 - esVEIndex ID = 269 - etIndex ID = 270 - etEEIndex ID = 271 - euIndex ID = 272 - euESIndex ID = 273 - ewoIndex ID = 274 - ewoCMIndex ID = 275 - faIndex ID = 276 - faAFIndex ID = 277 - faIRIndex ID = 278 - ffIndex ID = 279 - ffCMIndex ID = 280 - ffGNIndex ID = 281 - ffMRIndex ID = 282 - ffSNIndex ID = 283 - fiIndex ID = 284 - fiFIIndex ID = 285 - filIndex ID = 286 - filPHIndex ID = 287 - foIndex ID = 288 - foDKIndex ID = 289 - foFOIndex ID = 290 - frIndex ID = 291 - frBEIndex ID = 292 - frBFIndex ID = 293 - frBIIndex ID = 294 - frBJIndex ID = 295 - frBLIndex ID = 296 - frCAIndex ID = 297 - frCDIndex ID = 298 - frCFIndex ID = 299 - frCGIndex ID = 300 - frCHIndex ID = 301 - frCIIndex ID = 302 - frCMIndex ID = 303 - frDJIndex ID = 304 - frDZIndex ID = 305 - frFRIndex ID = 306 - frGAIndex ID = 307 - frGFIndex ID = 308 - frGNIndex ID = 309 - frGPIndex ID = 310 - frGQIndex ID = 311 - frHTIndex ID = 312 - frKMIndex ID = 313 - frLUIndex ID = 314 - frMAIndex ID = 315 - frMCIndex ID = 316 - frMFIndex ID = 317 - frMGIndex ID = 318 - frMLIndex ID = 319 - frMQIndex ID = 320 - frMRIndex ID = 321 - frMUIndex ID = 322 - frNCIndex ID = 323 - frNEIndex ID = 324 - frPFIndex ID = 325 - frPMIndex ID = 326 - frREIndex ID = 327 - frRWIndex ID = 328 - frSCIndex ID = 329 - frSNIndex ID = 330 - frSYIndex ID = 331 - frTDIndex ID = 332 - frTGIndex ID = 333 - frTNIndex ID = 334 - frVUIndex ID = 335 - frWFIndex ID = 336 - frYTIndex ID = 337 - furIndex ID = 338 - furITIndex ID = 339 - fyIndex ID = 340 - fyNLIndex ID = 341 - gaIndex ID = 342 - gaIEIndex ID = 343 - gdIndex ID = 344 - gdGBIndex ID = 345 - glIndex ID = 346 - glESIndex ID = 347 - gswIndex ID = 348 - gswCHIndex ID = 349 - gswFRIndex ID = 350 - gswLIIndex ID = 351 - guIndex ID = 352 - guINIndex ID = 353 - guwIndex ID = 354 - guzIndex ID = 355 - guzKEIndex ID = 356 - gvIndex ID = 357 - gvIMIndex ID = 358 - haIndex ID = 359 - haGHIndex ID = 360 - haNEIndex ID = 361 - haNGIndex ID = 362 - hawIndex ID = 363 - hawUSIndex ID = 364 - heIndex ID = 365 - heILIndex ID = 366 - hiIndex ID = 367 - hiINIndex ID = 368 - hrIndex ID = 369 - hrBAIndex ID = 370 - hrHRIndex ID = 371 - hsbIndex ID = 372 - hsbDEIndex ID = 373 - huIndex ID = 374 - huHUIndex ID = 375 - hyIndex ID = 376 - hyAMIndex ID = 377 - idIndex ID = 378 - idIDIndex ID = 379 - igIndex ID = 380 - igNGIndex ID = 381 - iiIndex ID = 382 - iiCNIndex ID = 383 - inIndex ID = 384 - ioIndex ID = 385 - isIndex ID = 386 - isISIndex ID = 387 - itIndex ID = 388 - itCHIndex ID = 389 - itITIndex ID = 390 - itSMIndex ID = 391 - itVAIndex ID = 392 - iuIndex ID = 393 - iwIndex ID = 394 - jaIndex ID = 395 - jaJPIndex ID = 396 - jboIndex ID = 397 - jgoIndex ID = 398 - jgoCMIndex ID = 399 - jiIndex ID = 400 - jmcIndex ID = 401 - jmcTZIndex ID = 402 - jvIndex ID = 403 - jwIndex ID = 404 - kaIndex ID = 405 - kaGEIndex ID = 406 - kabIndex ID = 407 - kabDZIndex ID = 408 - kajIndex ID = 409 - kamIndex ID = 410 - kamKEIndex ID = 411 - kcgIndex ID = 412 - kdeIndex ID = 413 - kdeTZIndex ID = 414 - keaIndex ID = 415 - keaCVIndex ID = 416 - khqIndex ID = 417 - khqMLIndex ID = 418 - kiIndex ID = 419 - kiKEIndex ID = 420 - kkIndex ID = 421 - kkKZIndex ID = 422 - kkjIndex ID = 423 - kkjCMIndex ID = 424 - klIndex ID = 425 - klGLIndex ID = 426 - klnIndex ID = 427 - klnKEIndex ID = 428 - kmIndex ID = 429 - kmKHIndex ID = 430 - knIndex ID = 431 - knINIndex ID = 432 - koIndex ID = 433 - koKPIndex ID = 434 - koKRIndex ID = 435 - kokIndex ID = 436 - kokINIndex ID = 437 - ksIndex ID = 438 - ksINIndex ID = 439 - ksbIndex ID = 440 - ksbTZIndex ID = 441 - ksfIndex ID = 442 - ksfCMIndex ID = 443 - kshIndex ID = 444 - kshDEIndex ID = 445 - kuIndex ID = 446 - kwIndex ID = 447 - kwGBIndex ID = 448 - kyIndex ID = 449 - kyKGIndex ID = 450 - lagIndex ID = 451 - lagTZIndex ID = 452 - lbIndex ID = 453 - lbLUIndex ID = 454 - lgIndex ID = 455 - lgUGIndex ID = 456 - lktIndex ID = 457 - lktUSIndex ID = 458 - lnIndex ID = 459 - lnAOIndex ID = 460 - lnCDIndex ID = 461 - lnCFIndex ID = 462 - lnCGIndex ID = 463 - loIndex ID = 464 - loLAIndex ID = 465 - lrcIndex ID = 466 - lrcIQIndex ID = 467 - lrcIRIndex ID = 468 - ltIndex ID = 469 - ltLTIndex ID = 470 - luIndex ID = 471 - luCDIndex ID = 472 - luoIndex ID = 473 - luoKEIndex ID = 474 - luyIndex ID = 475 - luyKEIndex ID = 476 - lvIndex ID = 477 - lvLVIndex ID = 478 - masIndex ID = 479 - masKEIndex ID = 480 - masTZIndex ID = 481 - merIndex ID = 482 - merKEIndex ID = 483 - mfeIndex ID = 484 - mfeMUIndex ID = 485 - mgIndex ID = 486 - mgMGIndex ID = 487 - mghIndex ID = 488 - mghMZIndex ID = 489 - mgoIndex ID = 490 - mgoCMIndex ID = 491 - mkIndex ID = 492 - mkMKIndex ID = 493 - mlIndex ID = 494 - mlINIndex ID = 495 - mnIndex ID = 496 - mnMNIndex ID = 497 - moIndex ID = 498 - mrIndex ID = 499 - mrINIndex ID = 500 - msIndex ID = 501 - msBNIndex ID = 502 - msMYIndex ID = 503 - msSGIndex ID = 504 - mtIndex ID = 505 - mtMTIndex ID = 506 - muaIndex ID = 507 - muaCMIndex ID = 508 - myIndex ID = 509 - myMMIndex ID = 510 - mznIndex ID = 511 - mznIRIndex ID = 512 - nahIndex ID = 513 - naqIndex ID = 514 - naqNAIndex ID = 515 - nbIndex ID = 516 - nbNOIndex ID = 517 - nbSJIndex ID = 518 - ndIndex ID = 519 - ndZWIndex ID = 520 - ndsIndex ID = 521 - ndsDEIndex ID = 522 - ndsNLIndex ID = 523 - neIndex ID = 524 - neINIndex ID = 525 - neNPIndex ID = 526 - nlIndex ID = 527 - nlAWIndex ID = 528 - nlBEIndex ID = 529 - nlBQIndex ID = 530 - nlCWIndex ID = 531 - nlNLIndex ID = 532 - nlSRIndex ID = 533 - nlSXIndex ID = 534 - nmgIndex ID = 535 - nmgCMIndex ID = 536 - nnIndex ID = 537 - nnNOIndex ID = 538 - nnhIndex ID = 539 - nnhCMIndex ID = 540 - noIndex ID = 541 - nqoIndex ID = 542 - nrIndex ID = 543 - nsoIndex ID = 544 - nusIndex ID = 545 - nusSSIndex ID = 546 - nyIndex ID = 547 - nynIndex ID = 548 - nynUGIndex ID = 549 - omIndex ID = 550 - omETIndex ID = 551 - omKEIndex ID = 552 - orIndex ID = 553 - orINIndex ID = 554 - osIndex ID = 555 - osGEIndex ID = 556 - osRUIndex ID = 557 - paIndex ID = 558 - paArabIndex ID = 559 - paArabPKIndex ID = 560 - paGuruIndex ID = 561 - paGuruINIndex ID = 562 - papIndex ID = 563 - plIndex ID = 564 - plPLIndex ID = 565 - prgIndex ID = 566 - prg001Index ID = 567 - psIndex ID = 568 - psAFIndex ID = 569 - ptIndex ID = 570 - ptAOIndex ID = 571 - ptBRIndex ID = 572 - ptCHIndex ID = 573 - ptCVIndex ID = 574 - ptGQIndex ID = 575 - ptGWIndex ID = 576 - ptLUIndex ID = 577 - ptMOIndex ID = 578 - ptMZIndex ID = 579 - ptPTIndex ID = 580 - ptSTIndex ID = 581 - ptTLIndex ID = 582 - quIndex ID = 583 - quBOIndex ID = 584 - quECIndex ID = 585 - quPEIndex ID = 586 - rmIndex ID = 587 - rmCHIndex ID = 588 - rnIndex ID = 589 - rnBIIndex ID = 590 - roIndex ID = 591 - roMDIndex ID = 592 - roROIndex ID = 593 - rofIndex ID = 594 - rofTZIndex ID = 595 - ruIndex ID = 596 - ruBYIndex ID = 597 - ruKGIndex ID = 598 - ruKZIndex ID = 599 - ruMDIndex ID = 600 - ruRUIndex ID = 601 - ruUAIndex ID = 602 - rwIndex ID = 603 - rwRWIndex ID = 604 - rwkIndex ID = 605 - rwkTZIndex ID = 606 - sahIndex ID = 607 - sahRUIndex ID = 608 - saqIndex ID = 609 - saqKEIndex ID = 610 - sbpIndex ID = 611 - sbpTZIndex ID = 612 - sdIndex ID = 613 - sdPKIndex ID = 614 - sdhIndex ID = 615 - seIndex ID = 616 - seFIIndex ID = 617 - seNOIndex ID = 618 - seSEIndex ID = 619 - sehIndex ID = 620 - sehMZIndex ID = 621 - sesIndex ID = 622 - sesMLIndex ID = 623 - sgIndex ID = 624 - sgCFIndex ID = 625 - shIndex ID = 626 - shiIndex ID = 627 - shiLatnIndex ID = 628 - shiLatnMAIndex ID = 629 - shiTfngIndex ID = 630 - shiTfngMAIndex ID = 631 - siIndex ID = 632 - siLKIndex ID = 633 - skIndex ID = 634 - skSKIndex ID = 635 - slIndex ID = 636 - slSIIndex ID = 637 - smaIndex ID = 638 - smiIndex ID = 639 - smjIndex ID = 640 - smnIndex ID = 641 - smnFIIndex ID = 642 - smsIndex ID = 643 - snIndex ID = 644 - snZWIndex ID = 645 - soIndex ID = 646 - soDJIndex ID = 647 - soETIndex ID = 648 - soKEIndex ID = 649 - soSOIndex ID = 650 - sqIndex ID = 651 - sqALIndex ID = 652 - sqMKIndex ID = 653 - sqXKIndex ID = 654 - srIndex ID = 655 - srCyrlIndex ID = 656 - srCyrlBAIndex ID = 657 - srCyrlMEIndex ID = 658 - srCyrlRSIndex ID = 659 - srCyrlXKIndex ID = 660 - srLatnIndex ID = 661 - srLatnBAIndex ID = 662 - srLatnMEIndex ID = 663 - srLatnRSIndex ID = 664 - srLatnXKIndex ID = 665 - ssIndex ID = 666 - ssyIndex ID = 667 - stIndex ID = 668 - svIndex ID = 669 - svAXIndex ID = 670 - svFIIndex ID = 671 - svSEIndex ID = 672 - swIndex ID = 673 - swCDIndex ID = 674 - swKEIndex ID = 675 - swTZIndex ID = 676 - swUGIndex ID = 677 - syrIndex ID = 678 - taIndex ID = 679 - taINIndex ID = 680 - taLKIndex ID = 681 - taMYIndex ID = 682 - taSGIndex ID = 683 - teIndex ID = 684 - teINIndex ID = 685 - teoIndex ID = 686 - teoKEIndex ID = 687 - teoUGIndex ID = 688 - tgIndex ID = 689 - tgTJIndex ID = 690 - thIndex ID = 691 - thTHIndex ID = 692 - tiIndex ID = 693 - tiERIndex ID = 694 - tiETIndex ID = 695 - tigIndex ID = 696 - tkIndex ID = 697 - tkTMIndex ID = 698 - tlIndex ID = 699 - tnIndex ID = 700 - toIndex ID = 701 - toTOIndex ID = 702 - trIndex ID = 703 - trCYIndex ID = 704 - trTRIndex ID = 705 - tsIndex ID = 706 - ttIndex ID = 707 - ttRUIndex ID = 708 - twqIndex ID = 709 - twqNEIndex ID = 710 - tzmIndex ID = 711 - tzmMAIndex ID = 712 - ugIndex ID = 713 - ugCNIndex ID = 714 - ukIndex ID = 715 - ukUAIndex ID = 716 - urIndex ID = 717 - urINIndex ID = 718 - urPKIndex ID = 719 - uzIndex ID = 720 - uzArabIndex ID = 721 - uzArabAFIndex ID = 722 - uzCyrlIndex ID = 723 - uzCyrlUZIndex ID = 724 - uzLatnIndex ID = 725 - uzLatnUZIndex ID = 726 - vaiIndex ID = 727 - vaiLatnIndex ID = 728 - vaiLatnLRIndex ID = 729 - vaiVaiiIndex ID = 730 - vaiVaiiLRIndex ID = 731 - veIndex ID = 732 - viIndex ID = 733 - viVNIndex ID = 734 - voIndex ID = 735 - vo001Index ID = 736 - vunIndex ID = 737 - vunTZIndex ID = 738 - waIndex ID = 739 - waeIndex ID = 740 - waeCHIndex ID = 741 - woIndex ID = 742 - woSNIndex ID = 743 - xhIndex ID = 744 - xogIndex ID = 745 - xogUGIndex ID = 746 - yavIndex ID = 747 - yavCMIndex ID = 748 - yiIndex ID = 749 - yi001Index ID = 750 - yoIndex ID = 751 - yoBJIndex ID = 752 - yoNGIndex ID = 753 - yueIndex ID = 754 - yueHansIndex ID = 755 - yueHansCNIndex ID = 756 - yueHantIndex ID = 757 - yueHantHKIndex ID = 758 - zghIndex ID = 759 - zghMAIndex ID = 760 - zhIndex ID = 761 - zhHansIndex ID = 762 - zhHansCNIndex ID = 763 - zhHansHKIndex ID = 764 - zhHansMOIndex ID = 765 - zhHansSGIndex ID = 766 - zhHantIndex ID = 767 - zhHantHKIndex ID = 768 - zhHantMOIndex ID = 769 - zhHantTWIndex ID = 770 - zuIndex ID = 771 - zuZAIndex ID = 772 - caESvalenciaIndex ID = 773 - enUSuvaposixIndex ID = 774 -) - -var coreTags = []language.CompactCoreInfo{ // 773 elements - // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d3, 0x01600162, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, - 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, - 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, - 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, - 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, - 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, - // Entry 20 - 3F - 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, - 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, - 0x04300000, 0x0430009a, 0x04400000, 0x04400130, - 0x04800000, 0x0480006f, 0x05800000, 0x05820000, - 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, - 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500163, 0x07900000, 0x07900130, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, - // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, - 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, - 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, - 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, - 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, - 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, - 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, - // Entry 60 - 7F - 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, - 0x10000000, 0x1000007c, 0x10100000, 0x10100064, - 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, - 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, - 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, - // Entry 80 - 9F - 0x13000000, 0x13000081, 0x13000123, 0x13600000, - 0x1360005e, 0x13600088, 0x13900000, 0x13900001, - 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, - 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, - 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, - 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, - 0x13900061, 0x13900062, 0x13900064, 0x13900065, - // Entry A0 - BF - 0x1390006e, 0x13900073, 0x13900074, 0x13900075, - 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, - 0x13900081, 0x13900082, 0x13900084, 0x1390008b, - 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, - 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, - 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, - 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, - 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, - // Entry C0 - DF - 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, - 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, - 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, - 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, - 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, - 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, - 0x1390010f, 0x13900110, 0x13900113, 0x13900118, - 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, - // Entry E0 - FF - 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, - 0x13900132, 0x13900134, 0x13900136, 0x1390013a, - 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, - 0x13900162, 0x13900163, 0x13900165, 0x13c00000, - 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, - 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, - 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, - // Entry 100 - 11F - 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, - 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, - 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, - 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, - 0x14500000, 0x1450006f, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, - 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, - 0x15100000, 0x15100073, 0x15300000, 0x153000e8, - // Entry 120 - 13F - 0x15800000, 0x15800064, 0x15800077, 0x15e00000, - 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, - 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, - 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, - 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, - 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, - 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, - // Entry 140 - 15F - 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, - 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, - 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, - 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, - 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, - 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, - 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, - 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, - // Entry 160 - 17F - 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, - 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, - 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, - 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, - 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, - 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, - 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, - // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, - 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, - 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a3, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, - 0x21200068, 0x21600000, 0x21700000, 0x217000a5, - 0x21f00000, 0x22300000, 0x22300130, 0x22700000, - // Entry 1A0 - 1BF - 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, - 0x239000a5, 0x24200000, 0x242000af, 0x24400000, - 0x24400052, 0x24500000, 0x24500083, 0x24600000, - 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, - 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, - 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, - 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, - // Entry 1C0 - 1DF - 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, - 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, - 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, - 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, - 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, - 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, - // Entry 1E0 - 1FF - 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, - 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, - 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, - 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, - 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, - 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, - 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, - // Entry 200 - 21F - 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, - 0x34700000, 0x347000db, 0x34700111, 0x34e00000, - 0x34e00165, 0x35000000, 0x35000061, 0x350000da, - 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005c, - 0x367000da, 0x36700117, 0x3670011c, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, - 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, - // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000118, 0x38700000, - 0x38900000, 0x38900132, 0x39000000, 0x39000070, - 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, - 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, - 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, - 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, - 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, - // Entry 240 - 25F - 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, - 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, - 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, - 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, - 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, - 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, - 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, - // Entry 260 - 27F - 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, - 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, - 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, - 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, - 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, - 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, - 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, - // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, - 0x42300000, 0x42300165, 0x42900000, 0x42900063, - 0x42900070, 0x429000a5, 0x42900116, 0x43100000, - 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, - 0x43220000, 0x43220033, 0x432200be, 0x43220106, - 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, - 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400073, - // Entry 2A0 - 2BF - 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, - 0x44500130, 0x44500132, 0x44e00000, 0x45000000, - 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, - 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, - 0x46400132, 0x46700000, 0x46700125, 0x46b00000, - 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, - 0x47100000, 0x47600000, 0x47600128, 0x47a00000, - 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, - // Entry 2C0 - 2DF - 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, - 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, - 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, - 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, - 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, - 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, - // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, - 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, - 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, - 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, - // Entry 300 - 31F - 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, - 0x52f00162, -} // Size: 3116 bytes - -const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" - -// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go deleted file mode 100644 index ca135d2..0000000 --- a/vendor/golang.org/x/text/internal/language/compact/tags.go +++ /dev/null @@ -1,91 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package compact - -var ( - und = Tag{} - - Und Tag = Tag{} - - Afrikaans Tag = Tag{language: afIndex, locale: afIndex} - Amharic Tag = Tag{language: amIndex, locale: amIndex} - Arabic Tag = Tag{language: arIndex, locale: arIndex} - ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} - Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} - Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} - Bengali Tag = Tag{language: bnIndex, locale: bnIndex} - Catalan Tag = Tag{language: caIndex, locale: caIndex} - Czech Tag = Tag{language: csIndex, locale: csIndex} - Danish Tag = Tag{language: daIndex, locale: daIndex} - German Tag = Tag{language: deIndex, locale: deIndex} - Greek Tag = Tag{language: elIndex, locale: elIndex} - English Tag = Tag{language: enIndex, locale: enIndex} - AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} - BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} - Spanish Tag = Tag{language: esIndex, locale: esIndex} - EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} - LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} - Estonian Tag = Tag{language: etIndex, locale: etIndex} - Persian Tag = Tag{language: faIndex, locale: faIndex} - Finnish Tag = Tag{language: fiIndex, locale: fiIndex} - Filipino Tag = Tag{language: filIndex, locale: filIndex} - French Tag = Tag{language: frIndex, locale: frIndex} - CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} - Gujarati Tag = Tag{language: guIndex, locale: guIndex} - Hebrew Tag = Tag{language: heIndex, locale: heIndex} - Hindi Tag = Tag{language: hiIndex, locale: hiIndex} - Croatian Tag = Tag{language: hrIndex, locale: hrIndex} - Hungarian Tag = Tag{language: huIndex, locale: huIndex} - Armenian Tag = Tag{language: hyIndex, locale: hyIndex} - Indonesian Tag = Tag{language: idIndex, locale: idIndex} - Icelandic Tag = Tag{language: isIndex, locale: isIndex} - Italian Tag = Tag{language: itIndex, locale: itIndex} - Japanese Tag = Tag{language: jaIndex, locale: jaIndex} - Georgian Tag = Tag{language: kaIndex, locale: kaIndex} - Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} - Khmer Tag = Tag{language: kmIndex, locale: kmIndex} - Kannada Tag = Tag{language: knIndex, locale: knIndex} - Korean Tag = Tag{language: koIndex, locale: koIndex} - Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} - Lao Tag = Tag{language: loIndex, locale: loIndex} - Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} - Latvian Tag = Tag{language: lvIndex, locale: lvIndex} - Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} - Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} - Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} - Marathi Tag = Tag{language: mrIndex, locale: mrIndex} - Malay Tag = Tag{language: msIndex, locale: msIndex} - Burmese Tag = Tag{language: myIndex, locale: myIndex} - Nepali Tag = Tag{language: neIndex, locale: neIndex} - Dutch Tag = Tag{language: nlIndex, locale: nlIndex} - Norwegian Tag = Tag{language: noIndex, locale: noIndex} - Punjabi Tag = Tag{language: paIndex, locale: paIndex} - Polish Tag = Tag{language: plIndex, locale: plIndex} - Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} - BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} - EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} - Romanian Tag = Tag{language: roIndex, locale: roIndex} - Russian Tag = Tag{language: ruIndex, locale: ruIndex} - Sinhala Tag = Tag{language: siIndex, locale: siIndex} - Slovak Tag = Tag{language: skIndex, locale: skIndex} - Slovenian Tag = Tag{language: slIndex, locale: slIndex} - Albanian Tag = Tag{language: sqIndex, locale: sqIndex} - Serbian Tag = Tag{language: srIndex, locale: srIndex} - SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} - Swedish Tag = Tag{language: svIndex, locale: svIndex} - Swahili Tag = Tag{language: swIndex, locale: swIndex} - Tamil Tag = Tag{language: taIndex, locale: taIndex} - Telugu Tag = Tag{language: teIndex, locale: teIndex} - Thai Tag = Tag{language: thIndex, locale: thIndex} - Turkish Tag = Tag{language: trIndex, locale: trIndex} - Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} - Urdu Tag = Tag{language: urIndex, locale: urIndex} - Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} - Vietnamese Tag = Tag{language: viIndex, locale: viIndex} - Chinese Tag = Tag{language: zhIndex, locale: zhIndex} - SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} - TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} - Zulu Tag = Tag{language: zuIndex, locale: zuIndex} -) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go deleted file mode 100644 index 4ae78e0..0000000 --- a/vendor/golang.org/x/text/internal/language/compose.go +++ /dev/null @@ -1,167 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "sort" - "strings" -) - -// A Builder allows constructing a Tag from individual components. -// Its main user is Compose in the top-level language package. -type Builder struct { - Tag Tag - - private string // the x extension - variants []string - extensions []string -} - -// Make returns a new Tag from the current settings. -func (b *Builder) Make() Tag { - t := b.Tag - - if len(b.extensions) > 0 || len(b.variants) > 0 { - sort.Sort(sortVariants(b.variants)) - sort.Strings(b.extensions) - - if b.private != "" { - b.extensions = append(b.extensions, b.private) - } - n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) - buf := make([]byte, n) - p := t.genCoreBytes(buf) - t.pVariant = byte(p) - p += appendTokens(buf[p:], b.variants...) - t.pExt = uint16(p) - p += appendTokens(buf[p:], b.extensions...) - t.str = string(buf[:p]) - // We may not always need to remake the string, but when or when not - // to do so is rather tricky. - scan := makeScanner(buf[:p]) - t, _ = parse(&scan, "") - return t - - } else if b.private != "" { - t.str = b.private - t.RemakeString() - } - return t -} - -// SetTag copies all the settings from a given Tag. Any previously set values -// are discarded. -func (b *Builder) SetTag(t Tag) { - b.Tag.LangID = t.LangID - b.Tag.RegionID = t.RegionID - b.Tag.ScriptID = t.ScriptID - // TODO: optimize - b.variants = b.variants[:0] - if variants := t.Variants(); variants != "" { - for _, vr := range strings.Split(variants[1:], "-") { - b.variants = append(b.variants, vr) - } - } - b.extensions, b.private = b.extensions[:0], "" - for _, e := range t.Extensions() { - b.AddExt(e) - } -} - -// AddExt adds extension e to the tag. e must be a valid extension as returned -// by Tag.Extension. If the extension already exists, it will be discarded, -// except for a -u extension, where non-existing key-type pairs will added. -func (b *Builder) AddExt(e string) { - if e[0] == 'x' { - if b.private == "" { - b.private = e - } - return - } - for i, s := range b.extensions { - if s[0] == e[0] { - if e[0] == 'u' { - b.extensions[i] += e[1:] - } - return - } - } - b.extensions = append(b.extensions, e) -} - -// SetExt sets the extension e to the tag. e must be a valid extension as -// returned by Tag.Extension. If the extension already exists, it will be -// overwritten, except for a -u extension, where the individual key-type pairs -// will be set. -func (b *Builder) SetExt(e string) { - if e[0] == 'x' { - b.private = e - return - } - for i, s := range b.extensions { - if s[0] == e[0] { - if e[0] == 'u' { - b.extensions[i] = e + s[1:] - } else { - b.extensions[i] = e - } - return - } - } - b.extensions = append(b.extensions, e) -} - -// AddVariant adds any number of variants. -func (b *Builder) AddVariant(v ...string) { - for _, v := range v { - if v != "" { - b.variants = append(b.variants, v) - } - } -} - -// ClearVariants removes any variants previously added, including those -// copied from a Tag in SetTag. -func (b *Builder) ClearVariants() { - b.variants = b.variants[:0] -} - -// ClearExtensions removes any extensions previously added, including those -// copied from a Tag in SetTag. -func (b *Builder) ClearExtensions() { - b.private = "" - b.extensions = b.extensions[:0] -} - -func tokenLen(token ...string) (n int) { - for _, t := range token { - n += len(t) + 1 - } - return -} - -func appendTokens(b []byte, token ...string) int { - p := 0 - for _, t := range token { - b[p] = '-' - copy(b[p+1:], t) - p += 1 + len(t) - } - return p -} - -type sortVariants []string - -func (s sortVariants) Len() int { - return len(s) -} - -func (s sortVariants) Swap(i, j int) { - s[j], s[i] = s[i], s[j] -} - -func (s sortVariants) Less(i, j int) bool { - return variantIndex[s[i]] < variantIndex[s[j]] -} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go deleted file mode 100644 index 9b20b88..0000000 --- a/vendor/golang.org/x/text/internal/language/coverage.go +++ /dev/null @@ -1,28 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// BaseLanguages returns the list of all supported base languages. It generates -// the list by traversing the internal structures. -func BaseLanguages() []Language { - base := make([]Language, 0, NumLanguages) - for i := 0; i < langNoIndexOffset; i++ { - // We included "und" already for the value 0. - if i != nonCanonicalUnd { - base = append(base, Language(i)) - } - } - i := langNoIndexOffset - for _, v := range langNoIndex { - for k := 0; k < 8; k++ { - if v&1 == 1 { - base = append(base, Language(i)) - } - v >>= 1 - i++ - } - } - return base -} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go deleted file mode 100644 index 09d41c7..0000000 --- a/vendor/golang.org/x/text/internal/language/language.go +++ /dev/null @@ -1,627 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_common.go -output tables.go - -package language // import "golang.org/x/text/internal/language" - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "errors" - "fmt" - "strings" -) - -const ( - // maxCoreSize is the maximum size of a BCP 47 tag without variants and - // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. - maxCoreSize = 12 - - // max99thPercentileSize is a somewhat arbitrary buffer size that presumably - // is large enough to hold at least 99% of the BCP 47 tags. - max99thPercentileSize = 32 - - // maxSimpleUExtensionSize is the maximum size of a -u extension with one - // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). - maxSimpleUExtensionSize = 14 -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. The zero value of Tag is Und. -type Tag struct { - // TODO: the following fields have the form TagTypeID. This name is chosen - // to allow refactoring the public package without conflicting with its - // Base, Script, and Region methods. Once the transition is fully completed - // the ID can be stripped from the name. - - LangID Language - RegionID Region - // TODO: we will soon run out of positions for ScriptID. Idea: instead of - // storing lang, region, and ScriptID codes, store only the compact index and - // have a lookup table from this code to its expansion. This greatly speeds - // up table lookup, speed up common variant cases. - // This will also immediately free up 3 extra bytes. Also, the pVariant - // field can now be moved to the lookup table, as the compact index uniquely - // determines the offset of a possible variant. - ScriptID Script - pVariant byte // offset in str, includes preceding '-' - pExt uint16 // offset of first extension, includes preceding '-' - - // str is the string representation of the Tag. It will only be used if the - // tag has variants or extensions. - str string -} - -// Make is a convenience wrapper for Parse that omits the error. -// In case of an error, a sensible default is returned. -func Make(s string) Tag { - t, _ := Parse(s) - return t -} - -// Raw returns the raw base language, script and region, without making an -// attempt to infer their values. -// TODO: consider removing -func (t Tag) Raw() (b Language, s Script, r Region) { - return t.LangID, t.ScriptID, t.RegionID -} - -// equalTags compares language, script and region subtags only. -func (t Tag) equalTags(a Tag) bool { - return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - if int(t.pVariant) < len(t.str) { - return false - } - return t.equalTags(Und) -} - -// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use -// tag. -func (t Tag) IsPrivateUse() bool { - return t.str != "" && t.pVariant == 0 -} - -// RemakeString is used to update t.str in case lang, script or region changed. -// It is assumed that pExt and pVariant still point to the start of the -// respective parts. -func (t *Tag) RemakeString() { - if t.str == "" { - return - } - extra := t.str[t.pVariant:] - if t.pVariant > 0 { - extra = extra[1:] - } - if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { - t.str = extra - t.pVariant = 0 - t.pExt = 0 - return - } - var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. - b := buf[:t.genCoreBytes(buf[:])] - if extra != "" { - diff := len(b) - int(t.pVariant) - b = append(b, '-') - b = append(b, extra...) - t.pVariant = uint8(int(t.pVariant) + diff) - t.pExt = uint16(int(t.pExt) + diff) - } else { - t.pVariant = uint8(len(b)) - t.pExt = uint16(len(b)) - } - t.str = string(b) -} - -// genCoreBytes writes a string for the base languages, script and region tags -// to the given buffer and returns the number of bytes written. It will never -// write more than maxCoreSize bytes. -func (t *Tag) genCoreBytes(buf []byte) int { - n := t.LangID.StringToBuf(buf[:]) - if t.ScriptID != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.ScriptID.String()) - } - if t.RegionID != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.RegionID.String()) - } - return n -} - -// String returns the canonical string representation of the language tag. -func (t Tag) String() string { - if t.str != "" { - return t.str - } - if t.ScriptID == 0 && t.RegionID == 0 { - return t.LangID.String() - } - buf := [maxCoreSize]byte{} - return string(buf[:t.genCoreBytes(buf[:])]) -} - -// MarshalText implements encoding.TextMarshaler. -func (t Tag) MarshalText() (text []byte, err error) { - if t.str != "" { - text = append(text, t.str...) - } else if t.ScriptID == 0 && t.RegionID == 0 { - text = append(text, t.LangID.String()...) - } else { - buf := [maxCoreSize]byte{} - text = buf[:t.genCoreBytes(buf[:])] - } - return text, nil -} - -// UnmarshalText implements encoding.TextUnmarshaler. -func (t *Tag) UnmarshalText(text []byte) error { - tag, err := Parse(string(text)) - *t = tag - return err -} - -// Variants returns the part of the tag holding all variants or the empty string -// if there are no variants defined. -func (t Tag) Variants() string { - if t.pVariant == 0 { - return "" - } - return t.str[t.pVariant:t.pExt] -} - -// VariantOrPrivateUseTags returns variants or private use tags. -func (t Tag) VariantOrPrivateUseTags() string { - if t.pExt > 0 { - return t.str[t.pVariant:t.pExt] - } - return t.str[t.pVariant:] -} - -// HasString reports whether this tag defines more than just the raw -// components. -func (t Tag) HasString() bool { - return t.str != "" -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -func (t Tag) Parent() Tag { - if t.str != "" { - // Strip the variants and extensions. - b, s, r := t.Raw() - t = Tag{LangID: b, ScriptID: s, RegionID: r} - if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID == t.ScriptID { - return Tag{LangID: t.LangID} - } - } - return t - } - if t.LangID != 0 { - if t.RegionID != 0 { - maxScript := t.ScriptID - if maxScript == 0 { - max, _ := addTags(t) - maxScript = max.ScriptID - } - - for i := range parents { - if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { - for _, r := range parents[i].fromRegion { - if Region(r) == t.RegionID { - return Tag{ - LangID: t.LangID, - ScriptID: Script(parents[i].script), - RegionID: Region(parents[i].toRegion), - } - } - } - } - } - - // Strip the script if it is the default one. - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID != maxScript { - return Tag{LangID: t.LangID, ScriptID: maxScript} - } - return Tag{LangID: t.LangID} - } else if t.ScriptID != 0 { - // The parent for an base-script pair with a non-default script is - // "und" instead of the base language. - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID != t.ScriptID { - return Und - } - return Tag{LangID: t.LangID} - } - } - return Und -} - -// ParseExtension parses s as an extension and returns it on success. -func ParseExtension(s string) (ext string, err error) { - defer func() { - if recover() != nil { - ext = "" - err = ErrSyntax - } - }() - - scan := makeScannerString(s) - var end int - if n := len(scan.token); n != 1 { - return "", ErrSyntax - } - scan.toLower(0, len(scan.b)) - end = parseExtension(&scan) - if end != len(s) { - return "", ErrSyntax - } - return string(scan.b), nil -} - -// HasVariants reports whether t has variants. -func (t Tag) HasVariants() bool { - return uint16(t.pVariant) < t.pExt -} - -// HasExtensions reports whether t has extensions. -func (t Tag) HasExtensions() bool { - return int(t.pExt) < len(t.str) -} - -// Extension returns the extension of type x for tag t. It will return -// false for ok if t does not have the requested extension. The returned -// extension will be invalid in this case. -func (t Tag) Extension(x byte) (ext string, ok bool) { - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - if ext[0] == x { - return ext, true - } - } - return "", false -} - -// Extensions returns all extensions of t. -func (t Tag) Extensions() []string { - e := []string{} - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - e = append(e, ext) - } - return e -} - -// TypeForKey returns the type associated with the given key, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// TypeForKey will traverse the inheritance chain to get the correct value. -// -// If there are multiple types associated with a key, only the first will be -// returned. If there is no type associated with a key, it returns the empty -// string. -func (t Tag) TypeForKey(key string) string { - if _, start, end, _ := t.findTypeForKey(key); end != start { - s := t.str[start:end] - if p := strings.IndexByte(s, '-'); p >= 0 { - s = s[:p] - } - return s - } - return "" -} - -var ( - errPrivateUse = errors.New("cannot set a key on a private use tag") - errInvalidArguments = errors.New("invalid key or type") -) - -// SetTypeForKey returns a new Tag with the key set to type, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// An empty value removes an existing pair with the same key. -func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - if t.IsPrivateUse() { - return t, errPrivateUse - } - if len(key) != 2 { - return t, errInvalidArguments - } - - // Remove the setting if value is "". - if value == "" { - start, sep, end, _ := t.findTypeForKey(key) - if start != sep { - // Remove a possible empty extension. - switch { - case t.str[start-2] != '-': // has previous elements. - case end == len(t.str), // end of string - end+2 < len(t.str) && t.str[end+2] == '-': // end of extension - start -= 2 - } - if start == int(t.pVariant) && end == len(t.str) { - t.str = "" - t.pVariant, t.pExt = 0, 0 - } else { - t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) - } - } - return t, nil - } - - if len(value) < 3 || len(value) > 8 { - return t, errInvalidArguments - } - - var ( - buf [maxCoreSize + maxSimpleUExtensionSize]byte - uStart int // start of the -u extension. - ) - - // Generate the tag string if needed. - if t.str == "" { - uStart = t.genCoreBytes(buf[:]) - buf[uStart] = '-' - uStart++ - } - - // Create new key-type pair and parse it to verify. - b := buf[uStart:] - copy(b, "u-") - copy(b[2:], key) - b[4] = '-' - b = b[:5+copy(b[5:], value)] - scan := makeScanner(b) - if parseExtensions(&scan); scan.err != nil { - return t, scan.err - } - - // Assemble the replacement string. - if t.str == "" { - t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) - t.str = string(buf[:uStart+len(b)]) - } else { - s := t.str - start, sep, end, hasExt := t.findTypeForKey(key) - if start == sep { - if hasExt { - b = b[2:] - } - t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) - } else { - t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) - } - } - return t, nil -} - -// findTypeForKey returns the start and end position for the type corresponding -// to key or the point at which to insert the key-value pair if the type -// wasn't found. The hasExt return value reports whether an -u extension was present. -// Note: the extensions are typically very small and are likely to contain -// only one key-type pair. -func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { - p := int(t.pExt) - if len(key) != 2 || p == len(t.str) || p == 0 { - return p, p, p, false - } - s := t.str - - // Find the correct extension. - for p++; s[p] != 'u'; p++ { - if s[p] > 'u' { - p-- - return p, p, p, false - } - if p = nextExtension(s, p); p == len(s) { - return len(s), len(s), len(s), false - } - } - // Proceed to the hyphen following the extension name. - p++ - - // curKey is the key currently being processed. - curKey := "" - - // Iterate over keys until we get the end of a section. - for { - end = p - for p++; p < len(s) && s[p] != '-'; p++ { - } - n := p - end - 1 - if n <= 2 && curKey == key { - if sep < end { - sep++ - } - return start, sep, end, true - } - switch n { - case 0, // invalid string - 1: // next extension - return end, end, end, true - case 2: - // next key - curKey = s[end+1 : p] - if curKey > key { - return end, end, end, true - } - start = end - sep = p - } - } -} - -// ParseBase parses a 2- or 3-letter ISO 639 code. -// It returns a ValueError if s is a well-formed but unknown language identifier -// or another error if another error occurred. -func ParseBase(s string) (l Language, err error) { - defer func() { - if recover() != nil { - l = 0 - err = ErrSyntax - } - }() - - if n := len(s); n < 2 || 3 < n { - return 0, ErrSyntax - } - var buf [3]byte - return getLangID(buf[:copy(buf[:], s)]) -} - -// ParseScript parses a 4-letter ISO 15924 code. -// It returns a ValueError if s is a well-formed but unknown script identifier -// or another error if another error occurred. -func ParseScript(s string) (scr Script, err error) { - defer func() { - if recover() != nil { - scr = 0 - err = ErrSyntax - } - }() - - if len(s) != 4 { - return 0, ErrSyntax - } - var buf [4]byte - return getScriptID(script, buf[:copy(buf[:], s)]) -} - -// EncodeM49 returns the Region for the given UN M.49 code. -// It returns an error if r is not a valid code. -func EncodeM49(r int) (Region, error) { - return getRegionM49(r) -} - -// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. -// It returns a ValueError if s is a well-formed but unknown region identifier -// or another error if another error occurred. -func ParseRegion(s string) (r Region, err error) { - defer func() { - if recover() != nil { - r = 0 - err = ErrSyntax - } - }() - - if n := len(s); n < 2 || 3 < n { - return 0, ErrSyntax - } - var buf [3]byte - return getRegionID(buf[:copy(buf[:], s)]) -} - -// IsCountry returns whether this region is a country or autonomous area. This -// includes non-standard definitions from CLDR. -func (r Region) IsCountry() bool { - if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { - return false - } - return true -} - -// IsGroup returns whether this region defines a collection of regions. This -// includes non-standard definitions from CLDR. -func (r Region) IsGroup() bool { - if r == 0 { - return false - } - return int(regionInclusion[r]) < len(regionContainment) -} - -// Contains returns whether Region c is contained by Region r. It returns true -// if c == r. -func (r Region) Contains(c Region) bool { - if r == c { - return true - } - g := regionInclusion[r] - if g >= nRegionGroups { - return false - } - m := regionContainment[g] - - d := regionInclusion[c] - b := regionInclusionBits[d] - - // A contained country may belong to multiple disjoint groups. Matching any - // of these indicates containment. If the contained region is a group, it - // must strictly be a subset. - if d >= nRegionGroups { - return b&m != 0 - } - return b&^m == 0 -} - -var errNoTLD = errors.New("language: region is not a valid ccTLD") - -// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. -// In all other cases it returns either the region itself or an error. -// -// This method may return an error for a region for which there exists a -// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The -// region will already be canonicalized it was obtained from a Tag that was -// obtained using any of the default methods. -func (r Region) TLD() (Region, error) { - // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the - // difference between ISO 3166-1 and IANA ccTLD. - if r == _GB { - r = _UK - } - if (r.typ() & ccTLD) == 0 { - return 0, errNoTLD - } - return r, nil -} - -// Canonicalize returns the region or a possible replacement if the region is -// deprecated. It will not return a replacement for deprecated regions that -// are split into multiple regions. -func (r Region) Canonicalize() Region { - if cr := normRegion(r); cr != 0 { - return cr - } - return r -} - -// Variant represents a registered variant of a language as defined by BCP 47. -type Variant struct { - ID uint8 - str string -} - -// ParseVariant parses and returns a Variant. An error is returned if s is not -// a valid variant. -func ParseVariant(s string) (v Variant, err error) { - defer func() { - if recover() != nil { - v = Variant{} - err = ErrSyntax - } - }() - - s = strings.ToLower(s) - if id, ok := variantIndex[s]; ok { - return Variant{id, s}, nil - } - return Variant{}, NewValueError([]byte(s)) -} - -// String returns the string representation of the variant. -func (v Variant) String() string { - return v.str -} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go deleted file mode 100644 index 231b4fb..0000000 --- a/vendor/golang.org/x/text/internal/language/lookup.go +++ /dev/null @@ -1,412 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "fmt" - "sort" - "strconv" - - "golang.org/x/text/internal/tag" -) - -// findIndex tries to find the given tag in idx and returns a standardized error -// if it could not be found. -func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { - if !tag.FixCase(form, key) { - return 0, ErrSyntax - } - i := idx.Index(key) - if i == -1 { - return 0, NewValueError(key) - } - return i, nil -} - -func searchUint(imap []uint16, key uint16) int { - return sort.Search(len(imap), func(i int) bool { - return imap[i] >= key - }) -} - -type Language uint16 - -// getLangID returns the langID of s if s is a canonical subtag -// or langUnknown if s is not a canonical subtag. -func getLangID(s []byte) (Language, error) { - if len(s) == 2 { - return getLangISO2(s) - } - return getLangISO3(s) -} - -// TODO language normalization as well as the AliasMaps could be moved to the -// higher level package, but it is a bit tricky to separate the generation. - -func (id Language) Canonicalize() (Language, AliasType) { - return normLang(id) -} - -// normLang returns the mapped langID of id according to mapping m. -func normLang(id Language) (Language, AliasType) { - k := sort.Search(len(AliasMap), func(i int) bool { - return AliasMap[i].From >= uint16(id) - }) - if k < len(AliasMap) && AliasMap[k].From == uint16(id) { - return Language(AliasMap[k].To), AliasTypes[k] - } - return id, AliasTypeUnknown -} - -// getLangISO2 returns the langID for the given 2-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO2(s []byte) (Language, error) { - if !tag.FixCase("zz", s) { - return 0, ErrSyntax - } - if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { - return Language(i), nil - } - return 0, NewValueError(s) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s []byte) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -// getLangISO3 returns the langID for the given 3-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO3(s []byte) (Language, error) { - if tag.FixCase("und", s) { - // first try to match canonical 3-letter entries - for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { - if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { - // We treat "und" as special and always translate it to "unspecified". - // Note that ZZ and Zzzz are private use and are not treated as - // unspecified by default. - id := Language(i) - if id == nonCanonicalUnd { - return 0, nil - } - return id, nil - } - } - if i := altLangISO3.Index(s); i != -1 { - return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil - } - n := strToInt(s) - if langNoIndex[n/8]&(1<<(n%8)) != 0 { - return Language(n) + langNoIndexOffset, nil - } - // Check for non-canonical uses of ISO3. - for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { - if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { - return Language(i), nil - } - } - return 0, NewValueError(s) - } - return 0, ErrSyntax -} - -// StringToBuf writes the string to b and returns the number of bytes -// written. cap(b) must be >= 3. -func (id Language) StringToBuf(b []byte) int { - if id >= langNoIndexOffset { - intToStr(uint(id)-langNoIndexOffset, b[:3]) - return 3 - } else if id == 0 { - return copy(b, "und") - } - l := lang[id<<2:] - if l[3] == 0 { - return copy(b, l[:3]) - } - return copy(b, l[:2]) -} - -// String returns the BCP 47 representation of the langID. -// Use b as variable name, instead of id, to ensure the variable -// used is consistent with that of Base in which this type is embedded. -func (b Language) String() string { - if b == 0 { - return "und" - } else if b >= langNoIndexOffset { - b -= langNoIndexOffset - buf := [3]byte{} - intToStr(uint(b), buf[:]) - return string(buf[:]) - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } - return l[:2] -} - -// ISO3 returns the ISO 639-3 language code. -func (b Language) ISO3() string { - if b == 0 || b >= langNoIndexOffset { - return b.String() - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } else if l[2] == 0 { - return altLangISO3.Elem(int(l[3]))[:3] - } - // This allocation will only happen for 3-letter ISO codes - // that are non-canonical BCP 47 language identifiers. - return l[0:1] + l[2:4] -} - -// IsPrivateUse reports whether this language code is reserved for private use. -func (b Language) IsPrivateUse() bool { - return langPrivateStart <= b && b <= langPrivateEnd -} - -// SuppressScript returns the script marked as SuppressScript in the IANA -// language tag repository, or 0 if there is no such script. -func (b Language) SuppressScript() Script { - if b < langNoIndexOffset { - return Script(suppressScript[b]) - } - return 0 -} - -type Region uint16 - -// getRegionID returns the region id for s if s is a valid 2-letter region code -// or unknownRegion. -func getRegionID(s []byte) (Region, error) { - if len(s) == 3 { - if isAlpha(s[0]) { - return getRegionISO3(s) - } - if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { - return getRegionM49(int(i)) - } - } - return getRegionISO2(s) -} - -// getRegionISO2 returns the regionID for the given 2-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO2(s []byte) (Region, error) { - i, err := findIndex(regionISO, s, "ZZ") - if err != nil { - return 0, err - } - return Region(i) + isoRegionOffset, nil -} - -// getRegionISO3 returns the regionID for the given 3-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO3(s []byte) (Region, error) { - if tag.FixCase("ZZZ", s) { - for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { - if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { - return Region(i) + isoRegionOffset, nil - } - } - for i := 0; i < len(altRegionISO3); i += 3 { - if tag.Compare(altRegionISO3[i:i+3], s) == 0 { - return Region(altRegionIDs[i/3]), nil - } - } - return 0, NewValueError(s) - } - return 0, ErrSyntax -} - -func getRegionM49(n int) (Region, error) { - if 0 < n && n <= 999 { - const ( - searchBits = 7 - regionBits = 9 - regionMask = 1<> searchBits - buf := fromM49[m49Index[idx]:m49Index[idx+1]] - val := uint16(n) << regionBits // we rely on bits shifting out - i := sort.Search(len(buf), func(i int) bool { - return buf[i] >= val - }) - if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { - return Region(r & regionMask), nil - } - } - var e ValueError - fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) - return 0, e -} - -// normRegion returns a region if r is deprecated or 0 otherwise. -// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). -// TODO: consider mapping split up regions to new most populous one (like CLDR). -func normRegion(r Region) Region { - m := regionOldMap - k := sort.Search(len(m), func(i int) bool { - return m[i].From >= uint16(r) - }) - if k < len(m) && m[k].From == uint16(r) { - return Region(m[k].To) - } - return 0 -} - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func (r Region) typ() byte { - return regionTypes[r] -} - -// String returns the BCP 47 representation for the region. -// It returns "ZZ" for an unspecified region. -func (r Region) String() string { - if r < isoRegionOffset { - if r == 0 { - return "ZZ" - } - return fmt.Sprintf("%03d", r.M49()) - } - r -= isoRegionOffset - return regionISO.Elem(int(r))[:2] -} - -// ISO3 returns the 3-letter ISO code of r. -// Note that not all regions have a 3-letter ISO code. -// In such cases this method returns "ZZZ". -func (r Region) ISO3() string { - if r < isoRegionOffset { - return "ZZZ" - } - r -= isoRegionOffset - reg := regionISO.Elem(int(r)) - switch reg[2] { - case 0: - return altRegionISO3[reg[3]:][:3] - case ' ': - return "ZZZ" - } - return reg[0:1] + reg[2:4] -} - -// M49 returns the UN M.49 encoding of r, or 0 if this encoding -// is not defined for r. -func (r Region) M49() int { - return int(m49[r]) -} - -// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This -// may include private-use tags that are assigned by CLDR and used in this -// implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r Region) IsPrivateUse() bool { - return r.typ()&iso3166UserAssigned != 0 -} - -type Script uint16 - -// getScriptID returns the script id for string s. It assumes that s -// is of the format [A-Z][a-z]{3}. -func getScriptID(idx tag.Index, s []byte) (Script, error) { - i, err := findIndex(idx, s, "Zzzz") - return Script(i), err -} - -// String returns the script code in title case. -// It returns "Zzzz" for an unspecified script. -func (s Script) String() string { - if s == 0 { - return "Zzzz" - } - return script.Elem(int(s)) -} - -// IsPrivateUse reports whether this script code is reserved for private use. -func (s Script) IsPrivateUse() bool { - return _Qaaa <= s && s <= _Qabx -} - -const ( - maxAltTaglen = len("en-US-POSIX") - maxLen = maxAltTaglen -) - -var ( - // grandfatheredMap holds a mapping from legacy and grandfathered tags to - // their base language or index to more elaborate tag. - grandfatheredMap = map[[maxLen]byte]int16{ - [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban - [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami - [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn - [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak - [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon - [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux - [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo - [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn - [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao - [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay - [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu - [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok - [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL - [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE - [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu - [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan - [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang - - // Grandfathered tags with no modern replacement will be converted as - // follows: - [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish - [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed - [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default - [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian - [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min - - // CLDR-specific tag. - [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root - [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" - } - - altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} - - altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" -) - -func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { - if v, ok := grandfatheredMap[s]; ok { - if v < 0 { - return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true - } - t.LangID = Language(v) - return t, true - } - return t, false -} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go deleted file mode 100644 index 75a2dbc..0000000 --- a/vendor/golang.org/x/text/internal/language/match.go +++ /dev/null @@ -1,226 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import "errors" - -type scriptRegionFlags uint8 - -const ( - isList = 1 << iota - scriptInFrom - regionInFrom -) - -func (t *Tag) setUndefinedLang(id Language) { - if t.LangID == 0 { - t.LangID = id - } -} - -func (t *Tag) setUndefinedScript(id Script) { - if t.ScriptID == 0 { - t.ScriptID = id - } -} - -func (t *Tag) setUndefinedRegion(id Region) { - if t.RegionID == 0 || t.RegionID.Contains(id) { - t.RegionID = id - } -} - -// ErrMissingLikelyTagsData indicates no information was available -// to compute likely values of missing tags. -var ErrMissingLikelyTagsData = errors.New("missing likely tags data") - -// addLikelySubtags sets subtags to their most likely value, given the locale. -// In most cases this means setting fields for unknown values, but in some -// cases it may alter a value. It returns an ErrMissingLikelyTagsData error -// if the given locale cannot be expanded. -func (t Tag) addLikelySubtags() (Tag, error) { - id, err := addTags(t) - if err != nil { - return t, err - } else if id.equalTags(t) { - return t, nil - } - id.RemakeString() - return id, nil -} - -// specializeRegion attempts to specialize a group region. -func specializeRegion(t *Tag) bool { - if i := regionInclusion[t.RegionID]; i < nRegionGroups { - x := likelyRegionGroup[i] - if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { - t.RegionID = Region(x.region) - } - return true - } - return false -} - -// Maximize returns a new tag with missing tags filled in. -func (t Tag) Maximize() (Tag, error) { - return addTags(t) -} - -func addTags(t Tag) (Tag, error) { - // We leave private use identifiers alone. - if t.IsPrivateUse() { - return t, nil - } - if t.ScriptID != 0 && t.RegionID != 0 { - if t.LangID != 0 { - // already fully specified - specializeRegion(&t) - return t, nil - } - // Search matches for und-script-region. Note that for these cases - // region will never be a group so there is no need to check for this. - list := likelyRegion[t.RegionID : t.RegionID+1] - if x := list[0]; x.flags&isList != 0 { - list = likelyRegionList[x.lang : x.lang+uint16(x.script)] - } - for _, x := range list { - // Deviating from the spec. See match_test.go for details. - if Script(x.script) == t.ScriptID { - t.setUndefinedLang(Language(x.lang)) - return t, nil - } - } - } - if t.LangID != 0 { - // Search matches for lang-script and lang-region, where lang != und. - if t.LangID < langNoIndexOffset { - x := likelyLang[t.LangID] - if x.flags&isList != 0 { - list := likelyLangList[x.region : x.region+uint16(x.script)] - if t.ScriptID != 0 { - for _, x := range list { - if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { - t.setUndefinedRegion(Region(x.region)) - return t, nil - } - } - } else if t.RegionID != 0 { - count := 0 - goodScript := true - tt := t - for _, x := range list { - // We visit all entries for which the script was not - // defined, including the ones where the region was not - // defined. This allows for proper disambiguation within - // regions. - if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { - tt.RegionID = Region(x.region) - tt.setUndefinedScript(Script(x.script)) - goodScript = goodScript && tt.ScriptID == Script(x.script) - count++ - } - } - if count == 1 { - return tt, nil - } - // Even if we fail to find a unique Region, we might have - // an unambiguous script. - if goodScript { - t.ScriptID = tt.ScriptID - } - } - } - } - } else { - // Search matches for und-script. - if t.ScriptID != 0 { - x := likelyScript[t.ScriptID] - if x.region != 0 { - t.setUndefinedRegion(Region(x.region)) - t.setUndefinedLang(Language(x.lang)) - return t, nil - } - } - // Search matches for und-region. If und-script-region exists, it would - // have been found earlier. - if t.RegionID != 0 { - if i := regionInclusion[t.RegionID]; i < nRegionGroups { - x := likelyRegionGroup[i] - if x.region != 0 { - t.setUndefinedLang(Language(x.lang)) - t.setUndefinedScript(Script(x.script)) - t.RegionID = Region(x.region) - } - } else { - x := likelyRegion[t.RegionID] - if x.flags&isList != 0 { - x = likelyRegionList[x.lang] - } - if x.script != 0 && x.flags != scriptInFrom { - t.setUndefinedLang(Language(x.lang)) - t.setUndefinedScript(Script(x.script)) - return t, nil - } - } - } - } - - // Search matches for lang. - if t.LangID < langNoIndexOffset { - x := likelyLang[t.LangID] - if x.flags&isList != 0 { - x = likelyLangList[x.region] - } - if x.region != 0 { - t.setUndefinedScript(Script(x.script)) - t.setUndefinedRegion(Region(x.region)) - } - specializeRegion(&t) - if t.LangID == 0 { - t.LangID = _en // default language - } - return t, nil - } - return t, ErrMissingLikelyTagsData -} - -func (t *Tag) setTagsFrom(id Tag) { - t.LangID = id.LangID - t.ScriptID = id.ScriptID - t.RegionID = id.RegionID -} - -// minimize removes the region or script subtags from t such that -// t.addLikelySubtags() == t.minimize().addLikelySubtags(). -func (t Tag) minimize() (Tag, error) { - t, err := minimizeTags(t) - if err != nil { - return t, err - } - t.RemakeString() - return t, nil -} - -// minimizeTags mimics the behavior of the ICU 51 C implementation. -func minimizeTags(t Tag) (Tag, error) { - if t.equalTags(Und) { - return t, nil - } - max, err := addTags(t) - if err != nil { - return t, err - } - for _, id := range [...]Tag{ - {LangID: t.LangID}, - {LangID: t.LangID, RegionID: t.RegionID}, - {LangID: t.LangID, ScriptID: t.ScriptID}, - } { - if x, err := addTags(id); err == nil && max.equalTags(x) { - t.setTagsFrom(id) - break - } - } - return t, nil -} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go deleted file mode 100644 index aad1e0a..0000000 --- a/vendor/golang.org/x/text/internal/language/parse.go +++ /dev/null @@ -1,608 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "errors" - "fmt" - "sort" - - "golang.org/x/text/internal/tag" -) - -// isAlpha returns true if the byte is not a digit. -// b must be an ASCII letter or digit. -func isAlpha(b byte) bool { - return b > '9' -} - -// isAlphaNum returns true if the string contains only ASCII letters or digits. -func isAlphaNum(s []byte) bool { - for _, c := range s { - if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { - return false - } - } - return true -} - -// ErrSyntax is returned by any of the parsing functions when the -// input is not well-formed, according to BCP 47. -// TODO: return the position at which the syntax error occurred? -var ErrSyntax = errors.New("language: tag is not well-formed") - -// ErrDuplicateKey is returned when a tag contains the same key twice with -// different values in the -u section. -var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") - -// ValueError is returned by any of the parsing functions when the -// input is well-formed but the respective subtag is not recognized -// as a valid value. -type ValueError struct { - v [8]byte -} - -// NewValueError creates a new ValueError. -func NewValueError(tag []byte) ValueError { - var e ValueError - copy(e.v[:], tag) - return e -} - -func (e ValueError) tag() []byte { - n := bytes.IndexByte(e.v[:], 0) - if n == -1 { - n = 8 - } - return e.v[:n] -} - -// Error implements the error interface. -func (e ValueError) Error() string { - return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) -} - -// Subtag returns the subtag for which the error occurred. -func (e ValueError) Subtag() string { - return string(e.tag()) -} - -// scanner is used to scan BCP 47 tokens, which are separated by _ or -. -type scanner struct { - b []byte - bytes [max99thPercentileSize]byte - token []byte - start int // start position of the current token - end int // end position of the current token - next int // next point for scan - err error - done bool -} - -func makeScannerString(s string) scanner { - scan := scanner{} - if len(s) <= len(scan.bytes) { - scan.b = scan.bytes[:copy(scan.bytes[:], s)] - } else { - scan.b = []byte(s) - } - scan.init() - return scan -} - -// makeScanner returns a scanner using b as the input buffer. -// b is not copied and may be modified by the scanner routines. -func makeScanner(b []byte) scanner { - scan := scanner{b: b} - scan.init() - return scan -} - -func (s *scanner) init() { - for i, c := range s.b { - if c == '_' { - s.b[i] = '-' - } - } - s.scan() -} - -// restToLower converts the string between start and end to lower case. -func (s *scanner) toLower(start, end int) { - for i := start; i < end; i++ { - c := s.b[i] - if 'A' <= c && c <= 'Z' { - s.b[i] += 'a' - 'A' - } - } -} - -func (s *scanner) setError(e error) { - if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { - s.err = e - } -} - -// resizeRange shrinks or grows the array at position oldStart such that -// a new string of size newSize can fit between oldStart and oldEnd. -// Sets the scan point to after the resized range. -func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { - s.start = oldStart - if end := oldStart + newSize; end != oldEnd { - diff := end - oldEnd - var b []byte - if n := len(s.b) + diff; n > cap(s.b) { - b = make([]byte, n) - copy(b, s.b[:oldStart]) - } else { - b = s.b[:n] - } - copy(b[end:], s.b[oldEnd:]) - s.b = b - s.next = end + (s.next - s.end) - s.end = end - } -} - -// replace replaces the current token with repl. -func (s *scanner) replace(repl string) { - s.resizeRange(s.start, s.end, len(repl)) - copy(s.b[s.start:], repl) -} - -// gobble removes the current token from the input. -// Caller must call scan after calling gobble. -func (s *scanner) gobble(e error) { - s.setError(e) - if s.start == 0 { - s.b = s.b[:+copy(s.b, s.b[s.next:])] - s.end = 0 - } else { - s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] - s.end = s.start - 1 - } - s.next = s.start -} - -// deleteRange removes the given range from s.b before the current token. -func (s *scanner) deleteRange(start, end int) { - s.b = s.b[:start+copy(s.b[start:], s.b[end:])] - diff := end - start - s.next -= diff - s.start -= diff - s.end -= diff -} - -// scan parses the next token of a BCP 47 string. Tokens that are larger -// than 8 characters or include non-alphanumeric characters result in an error -// and are gobbled and removed from the output. -// It returns the end position of the last token consumed. -func (s *scanner) scan() (end int) { - end = s.end - s.token = nil - for s.start = s.next; s.next < len(s.b); { - i := bytes.IndexByte(s.b[s.next:], '-') - if i == -1 { - s.end = len(s.b) - s.next = len(s.b) - i = s.end - s.start - } else { - s.end = s.next + i - s.next = s.end + 1 - } - token := s.b[s.start:s.end] - if i < 1 || i > 8 || !isAlphaNum(token) { - s.gobble(ErrSyntax) - continue - } - s.token = token - return end - } - if n := len(s.b); n > 0 && s.b[n-1] == '-' { - s.setError(ErrSyntax) - s.b = s.b[:len(s.b)-1] - } - s.done = true - return end -} - -// acceptMinSize parses multiple tokens of the given size or greater. -// It returns the end position of the last token consumed. -func (s *scanner) acceptMinSize(min int) (end int) { - end = s.end - s.scan() - for ; len(s.token) >= min; s.scan() { - end = s.end - } - return end -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -func Parse(s string) (t Tag, err error) { - // TODO: consider supporting old-style locale key-value pairs. - if s == "" { - return Und, ErrSyntax - } - defer func() { - if recover() != nil { - t = Und - err = ErrSyntax - return - } - }() - if len(s) <= maxAltTaglen { - b := [maxAltTaglen]byte{} - for i, c := range s { - // Generating invalid UTF-8 is okay as it won't match. - if 'A' <= c && c <= 'Z' { - c += 'a' - 'A' - } else if c == '_' { - c = '-' - } - b[i] = byte(c) - } - if t, ok := grandfathered(b); ok { - return t, nil - } - } - scan := makeScannerString(s) - return parse(&scan, s) -} - -func parse(scan *scanner, s string) (t Tag, err error) { - t = Und - var end int - if n := len(scan.token); n <= 1 { - scan.toLower(0, len(scan.b)) - if n == 0 || scan.token[0] != 'x' { - return t, ErrSyntax - } - end = parseExtensions(scan) - } else if n >= 4 { - return Und, ErrSyntax - } else { // the usual case - t, end = parseTag(scan, true) - if n := len(scan.token); n == 1 { - t.pExt = uint16(end) - end = parseExtensions(scan) - } else if end < len(scan.b) { - scan.setError(ErrSyntax) - scan.b = scan.b[:end] - } - } - if int(t.pVariant) < len(scan.b) { - if end < len(s) { - s = s[:end] - } - if len(s) > 0 && tag.Compare(s, scan.b) == 0 { - t.str = s - } else { - t.str = string(scan.b) - } - } else { - t.pVariant, t.pExt = 0, 0 - } - return t, scan.err -} - -// parseTag parses language, script, region and variants. -// It returns a Tag and the end position in the input that was parsed. -// If doNorm is true, then - will be normalized to . -func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { - var e error - // TODO: set an error if an unknown lang, script or region is encountered. - t.LangID, e = getLangID(scan.token) - scan.setError(e) - scan.replace(t.LangID.String()) - langStart := scan.start - end = scan.scan() - for len(scan.token) == 3 && isAlpha(scan.token[0]) { - // From http://tools.ietf.org/html/bcp47, - tags are equivalent - // to a tag of the form . - if doNorm { - lang, e := getLangID(scan.token) - if lang != 0 { - t.LangID = lang - langStr := lang.String() - copy(scan.b[langStart:], langStr) - scan.b[langStart+len(langStr)] = '-' - scan.start = langStart + len(langStr) + 1 - } - scan.gobble(e) - } - end = scan.scan() - } - if len(scan.token) == 4 && isAlpha(scan.token[0]) { - t.ScriptID, e = getScriptID(script, scan.token) - if t.ScriptID == 0 { - scan.gobble(e) - } - end = scan.scan() - } - if n := len(scan.token); n >= 2 && n <= 3 { - t.RegionID, e = getRegionID(scan.token) - if t.RegionID == 0 { - scan.gobble(e) - } else { - scan.replace(t.RegionID.String()) - } - end = scan.scan() - } - scan.toLower(scan.start, len(scan.b)) - t.pVariant = byte(end) - end = parseVariants(scan, end, t) - t.pExt = uint16(end) - return t, end -} - -var separator = []byte{'-'} - -// parseVariants scans tokens as long as each token is a valid variant string. -// Duplicate variants are removed. -func parseVariants(scan *scanner, end int, t Tag) int { - start := scan.start - varIDBuf := [4]uint8{} - variantBuf := [4][]byte{} - varID := varIDBuf[:0] - variant := variantBuf[:0] - last := -1 - needSort := false - for ; len(scan.token) >= 4; scan.scan() { - // TODO: measure the impact of needing this conversion and redesign - // the data structure if there is an issue. - v, ok := variantIndex[string(scan.token)] - if !ok { - // unknown variant - // TODO: allow user-defined variants? - scan.gobble(NewValueError(scan.token)) - continue - } - varID = append(varID, v) - variant = append(variant, scan.token) - if !needSort { - if last < int(v) { - last = int(v) - } else { - needSort = true - // There is no legal combinations of more than 7 variants - // (and this is by no means a useful sequence). - const maxVariants = 8 - if len(varID) > maxVariants { - break - } - } - } - end = scan.end - } - if needSort { - sort.Sort(variantsSort{varID, variant}) - k, l := 0, -1 - for i, v := range varID { - w := int(v) - if l == w { - // Remove duplicates. - continue - } - varID[k] = varID[i] - variant[k] = variant[i] - k++ - l = w - } - if str := bytes.Join(variant[:k], separator); len(str) == 0 { - end = start - 1 - } else { - scan.resizeRange(start, end, len(str)) - copy(scan.b[scan.start:], str) - end = scan.end - } - } - return end -} - -type variantsSort struct { - i []uint8 - v [][]byte -} - -func (s variantsSort) Len() int { - return len(s.i) -} - -func (s variantsSort) Swap(i, j int) { - s.i[i], s.i[j] = s.i[j], s.i[i] - s.v[i], s.v[j] = s.v[j], s.v[i] -} - -func (s variantsSort) Less(i, j int) bool { - return s.i[i] < s.i[j] -} - -type bytesSort struct { - b [][]byte - n int // first n bytes to compare -} - -func (b bytesSort) Len() int { - return len(b.b) -} - -func (b bytesSort) Swap(i, j int) { - b.b[i], b.b[j] = b.b[j], b.b[i] -} - -func (b bytesSort) Less(i, j int) bool { - for k := 0; k < b.n; k++ { - if b.b[i][k] == b.b[j][k] { - continue - } - return b.b[i][k] < b.b[j][k] - } - return false -} - -// parseExtensions parses and normalizes the extensions in the buffer. -// It returns the last position of scan.b that is part of any extension. -// It also trims scan.b to remove excess parts accordingly. -func parseExtensions(scan *scanner) int { - start := scan.start - exts := [][]byte{} - private := []byte{} - end := scan.end - for len(scan.token) == 1 { - extStart := scan.start - ext := scan.token[0] - end = parseExtension(scan) - extension := scan.b[extStart:end] - if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { - scan.setError(ErrSyntax) - end = extStart - continue - } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { - scan.b = scan.b[:end] - return end - } else if ext == 'x' { - private = extension - break - } - exts = append(exts, extension) - } - sort.Sort(bytesSort{exts, 1}) - if len(private) > 0 { - exts = append(exts, private) - } - scan.b = scan.b[:start] - if len(exts) > 0 { - scan.b = append(scan.b, bytes.Join(exts, separator)...) - } else if start > 0 { - // Strip trailing '-'. - scan.b = scan.b[:start-1] - } - return end -} - -// parseExtension parses a single extension and returns the position of -// the extension end. -func parseExtension(scan *scanner) int { - start, end := scan.start, scan.end - switch scan.token[0] { - case 'u': // https://www.ietf.org/rfc/rfc6067.txt - attrStart := end - scan.scan() - for last := []byte{}; len(scan.token) > 2; scan.scan() { - if bytes.Compare(scan.token, last) != -1 { - // Attributes are unsorted. Start over from scratch. - p := attrStart + 1 - scan.next = p - attrs := [][]byte{} - for scan.scan(); len(scan.token) > 2; scan.scan() { - attrs = append(attrs, scan.token) - end = scan.end - } - sort.Sort(bytesSort{attrs, 3}) - copy(scan.b[p:], bytes.Join(attrs, separator)) - break - } - last = scan.token - end = scan.end - } - // Scan key-type sequences. A key is of length 2 and may be followed - // by 0 or more "type" subtags from 3 to the maximum of 8 letters. - var last, key []byte - for attrEnd := end; len(scan.token) == 2; last = key { - key = scan.token - end = scan.end - for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { - end = scan.end - } - // TODO: check key value validity - if bytes.Compare(key, last) != 1 || scan.err != nil { - // We have an invalid key or the keys are not sorted. - // Start scanning keys from scratch and reorder. - p := attrEnd + 1 - scan.next = p - keys := [][]byte{} - for scan.scan(); len(scan.token) == 2; { - keyStart := scan.start - end = scan.end - for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { - end = scan.end - } - keys = append(keys, scan.b[keyStart:end]) - } - sort.Stable(bytesSort{keys, 2}) - if n := len(keys); n > 0 { - k := 0 - for i := 1; i < n; i++ { - if !bytes.Equal(keys[k][:2], keys[i][:2]) { - k++ - keys[k] = keys[i] - } else if !bytes.Equal(keys[k], keys[i]) { - scan.setError(ErrDuplicateKey) - } - } - keys = keys[:k+1] - } - reordered := bytes.Join(keys, separator) - if e := p + len(reordered); e < end { - scan.deleteRange(e, end) - end = e - } - copy(scan.b[p:], reordered) - break - } - } - case 't': // https://www.ietf.org/rfc/rfc6497.txt - scan.scan() - if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan, false) - scan.toLower(start, end) - } - for len(scan.token) == 2 && !isAlpha(scan.token[1]) { - end = scan.acceptMinSize(3) - } - case 'x': - end = scan.acceptMinSize(1) - default: - end = scan.acceptMinSize(2) - } - return end -} - -// getExtension returns the name, body and end position of the extension. -func getExtension(s string, p int) (end int, ext string) { - if s[p] == '-' { - p++ - } - if s[p] == 'x' { - return len(s), s[p:] - } - end = nextExtension(s, p) - return end, s[p:end] -} - -// nextExtension finds the next extension within the string, searching -// for the -- pattern from position p. -// In the fast majority of cases, language tags will have at most -// one extension and extensions tend to be small. -func nextExtension(s string, p int) int { - for n := len(s) - 3; p < n; { - if s[p] == '-' { - if s[p+2] == '-' { - return p - } - p += 3 - } else { - p++ - } - } - return len(s) -} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go deleted file mode 100644 index 14167e7..0000000 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ /dev/null @@ -1,3494 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -import "golang.org/x/text/internal/tag" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -const NumLanguages = 8798 - -const NumScripts = 261 - -const NumRegions = 358 - -type FromTo struct { - From uint16 - To uint16 -} - -const nonCanonicalUnd = 1201 -const ( - _af = 22 - _am = 39 - _ar = 58 - _az = 88 - _bg = 126 - _bn = 165 - _ca = 215 - _cs = 250 - _da = 257 - _de = 269 - _el = 310 - _en = 313 - _es = 318 - _et = 320 - _fa = 328 - _fi = 337 - _fil = 339 - _fr = 350 - _gu = 420 - _he = 444 - _hi = 446 - _hr = 465 - _hu = 469 - _hy = 471 - _id = 481 - _is = 504 - _it = 505 - _ja = 512 - _ka = 528 - _kk = 578 - _km = 586 - _kn = 593 - _ko = 596 - _ky = 650 - _lo = 696 - _lt = 704 - _lv = 711 - _mk = 767 - _ml = 772 - _mn = 779 - _mo = 784 - _mr = 795 - _ms = 799 - _mul = 806 - _my = 817 - _nb = 839 - _ne = 849 - _nl = 871 - _no = 879 - _pa = 925 - _pl = 947 - _pt = 960 - _ro = 988 - _ru = 994 - _sh = 1031 - _si = 1036 - _sk = 1042 - _sl = 1046 - _sq = 1073 - _sr = 1074 - _sv = 1092 - _sw = 1093 - _ta = 1104 - _te = 1121 - _th = 1131 - _tl = 1146 - _tn = 1152 - _tr = 1162 - _uk = 1198 - _ur = 1204 - _uz = 1212 - _vi = 1219 - _zh = 1321 - _zu = 1327 - _jbo = 515 - _ami = 1650 - _bnn = 2357 - _hak = 438 - _tlh = 14467 - _lb = 661 - _nv = 899 - _pwn = 12055 - _tao = 14188 - _tay = 14198 - _tsu = 14662 - _nn = 874 - _sfb = 13629 - _vgt = 15701 - _sgg = 13660 - _cmn = 3007 - _nan = 835 - _hsn = 467 -) - -const langPrivateStart = 0x2f72 - -const langPrivateEnd = 0x3179 - -// lang holds an alphabetically sorted list of ISO-639 language identifiers. -// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -// For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -// -// For 3-byte language identifiers the 4th byte is 0. -const lang tag.Index = "" + // Size: 5324 bytes - "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + - "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + - "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + - "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + - "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + - "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + - "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + - "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + - "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + - "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + - "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + - "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + - "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + - "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + - "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + - "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + - "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + - "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + - "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + - "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + - "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + - "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + - "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + - "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + - "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + - "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + - "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + - "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + - "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + - "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + - "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + - "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + - "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + - "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + - "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + - "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + - "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + - "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + - "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + - "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + - "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + - "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + - "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + - "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + - "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + - "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + - "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + - "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + - "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + - "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + - "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + - "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + - "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + - "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + - "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + - "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + - "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + - "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + - "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + - "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + - "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + - "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + - "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + - "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + - "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + - "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + - "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + - "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + - "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + - "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + - "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + - "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + - "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + - "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + - "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + - "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + - "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + - "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + - "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + - "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + - "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + - "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + - "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + - "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + - "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + - "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + - "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + - "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + - "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + - "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + - "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + - "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + - "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + - "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + - "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + - "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + - "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + - "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + - "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + - "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + - "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + - "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + - "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + - "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + - "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + - "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + - "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + - "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + - "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + - "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + - "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + - "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + - "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + - "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + - "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + - "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + - "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + - "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + - "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + - "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + - "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + - "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + - "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + - "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" - -const langNoIndexOffset = 1330 - -// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -// in lookup tables. The language ids for these language codes are derived directly -// from the letters and are not consecutive. -// Size: 2197 bytes, 2197 elements -var langNoIndex = [2197]uint8{ - // Entry 0 - 3F - 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, - 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, - 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, - 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, - 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, - 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, - // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, - 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, - 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, - 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, - 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, - 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, - // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, - 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, - 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, - 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, - 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, - 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, - 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, - // Entry C0 - FF - 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, - 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, - 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, - // Entry 100 - 13F - 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, - 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, - 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, - // Entry 140 - 17F - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, - 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, - 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, - 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, - // Entry 180 - 1BF - 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, - 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, - 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, - 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, - // Entry 200 - 23F - 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, - 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, - 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, - 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, - // Entry 240 - 27F - 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, - 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, - 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, - // Entry 280 - 2BF - 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, - 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, - 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, - 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, - 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, - 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, - // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, - 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, - // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, - 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, - 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, - 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, - // Entry 340 - 37F - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, - 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, - 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, - 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, - 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, - 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, - 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, - // Entry 380 - 3BF - 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, - 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, - 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, - 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, - 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, - 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, - 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, - // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, - 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, - 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, - 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, - 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, - // Entry 400 - 43F - 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, - 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, - 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, - 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, - 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, - 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, - 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, - // Entry 440 - 47F - 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, - 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, - 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, - 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, - 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, - 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, - 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, - 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, - // Entry 480 - 4BF - 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, - 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, - 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, - // Entry 4C0 - 4FF - 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, - 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, - 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, - // Entry 500 - 53F - 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, - 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, - // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - // Entry 580 - 5BF - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, - 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, - 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, - 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, - // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, - 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, - 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, - 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, - // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, - 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, - 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, - 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, - 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, - // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, - 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, - 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, - 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, - 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, - 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, - 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, - // Entry 680 - 6BF - 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, - 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, - 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, - 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, - // Entry 6C0 - 6FF - 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, - 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, - 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, - 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, - // Entry 700 - 73F - 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, - 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, - 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, - 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, - 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, - 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, - 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, - 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, - 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, - // Entry 780 - 7BF - 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, - 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, - 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, - // Entry 7C0 - 7FF - 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, - 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, - 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, - 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, - // Entry 800 - 83F - 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, - 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, - 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, - 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, - // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, - 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, - 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, - 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, - 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, - // Entry 880 - 8BF - 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, - 0x0a, 0x00, 0x80, 0x00, 0x00, -} - -// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -// to 2-letter language codes that cannot be derived using the method described above. -// Each 3-letter code is followed by its 1-byte langID. -const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" - -// altLangIndex is used to convert indexes in altLangISO3 to langIDs. -// Size: 12 bytes, 6 elements -var altLangIndex = [6]uint16{ - 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, -} - -// AliasMap maps langIDs to their suggested replacements. -// Size: 772 bytes, 193 elements -var AliasMap = [193]FromTo{ - 0: {From: 0x82, To: 0x88}, - 1: {From: 0x187, To: 0x1ae}, - 2: {From: 0x1f3, To: 0x1e1}, - 3: {From: 0x1fb, To: 0x1bc}, - 4: {From: 0x208, To: 0x512}, - 5: {From: 0x20f, To: 0x20e}, - 6: {From: 0x310, To: 0x3dc}, - 7: {From: 0x347, To: 0x36f}, - 8: {From: 0x407, To: 0x432}, - 9: {From: 0x47a, To: 0x153}, - 10: {From: 0x490, To: 0x451}, - 11: {From: 0x4a2, To: 0x21}, - 12: {From: 0x53e, To: 0x544}, - 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x62b, To: 0x34}, - 15: {From: 0x62f, To: 0x14}, - 16: {From: 0x630, To: 0x1eb1}, - 17: {From: 0x651, To: 0x431}, - 18: {From: 0x662, To: 0x431}, - 19: {From: 0x6ed, To: 0x3a}, - 20: {From: 0x6f8, To: 0x1d7}, - 21: {From: 0x709, To: 0x3625}, - 22: {From: 0x73e, To: 0x21a1}, - 23: {From: 0x7b3, To: 0x56}, - 24: {From: 0x7b9, To: 0x299b}, - 25: {From: 0x7c5, To: 0x58}, - 26: {From: 0x7e6, To: 0x145}, - 27: {From: 0x80c, To: 0x5a}, - 28: {From: 0x815, To: 0x8d}, - 29: {From: 0x87e, To: 0x810}, - 30: {From: 0x8a8, To: 0x8b7}, - 31: {From: 0x8c3, To: 0xee3}, - 32: {From: 0x8fa, To: 0x1dc}, - 33: {From: 0x9ef, To: 0x331}, - 34: {From: 0xa36, To: 0x2c5}, - 35: {From: 0xa3d, To: 0xbf}, - 36: {From: 0xabe, To: 0x3322}, - 37: {From: 0xb38, To: 0x529}, - 38: {From: 0xb75, To: 0x265a}, - 39: {From: 0xb7e, To: 0xbc3}, - 40: {From: 0xb9b, To: 0x44e}, - 41: {From: 0xbbc, To: 0x4229}, - 42: {From: 0xbbf, To: 0x529}, - 43: {From: 0xbfe, To: 0x2da7}, - 44: {From: 0xc2e, To: 0x3181}, - 45: {From: 0xcb9, To: 0xf3}, - 46: {From: 0xd08, To: 0xfa}, - 47: {From: 0xdc8, To: 0x11a}, - 48: {From: 0xdd7, To: 0x32d}, - 49: {From: 0xdf8, To: 0xdfb}, - 50: {From: 0xdfe, To: 0x531}, - 51: {From: 0xe01, To: 0xdf3}, - 52: {From: 0xedf, To: 0x205a}, - 53: {From: 0xee9, To: 0x222e}, - 54: {From: 0xeee, To: 0x2e9a}, - 55: {From: 0xf39, To: 0x367}, - 56: {From: 0x10d0, To: 0x140}, - 57: {From: 0x1104, To: 0x2d0}, - 58: {From: 0x11a0, To: 0x1ec}, - 59: {From: 0x1279, To: 0x21}, - 60: {From: 0x1424, To: 0x15e}, - 61: {From: 0x1470, To: 0x14e}, - 62: {From: 0x151f, To: 0xd9b}, - 63: {From: 0x1523, To: 0x390}, - 64: {From: 0x1532, To: 0x19f}, - 65: {From: 0x1580, To: 0x210}, - 66: {From: 0x1583, To: 0x10d}, - 67: {From: 0x15a3, To: 0x3caf}, - 68: {From: 0x1630, To: 0x222e}, - 69: {From: 0x166a, To: 0x19b}, - 70: {From: 0x16c8, To: 0x136}, - 71: {From: 0x1700, To: 0x29f8}, - 72: {From: 0x1718, To: 0x194}, - 73: {From: 0x1727, To: 0xf3f}, - 74: {From: 0x177a, To: 0x178}, - 75: {From: 0x1809, To: 0x17b6}, - 76: {From: 0x1816, To: 0x18f3}, - 77: {From: 0x188a, To: 0x436}, - 78: {From: 0x1979, To: 0x1d01}, - 79: {From: 0x1a74, To: 0x2bb0}, - 80: {From: 0x1a8a, To: 0x1f8}, - 81: {From: 0x1b5a, To: 0x1fa}, - 82: {From: 0x1b86, To: 0x1515}, - 83: {From: 0x1d64, To: 0x2c9b}, - 84: {From: 0x2038, To: 0x37b1}, - 85: {From: 0x203d, To: 0x20dd}, - 86: {From: 0x2042, To: 0x2e00}, - 87: {From: 0x205a, To: 0x30b}, - 88: {From: 0x20e3, To: 0x274}, - 89: {From: 0x20ee, To: 0x263}, - 90: {From: 0x20f2, To: 0x22d}, - 91: {From: 0x20f9, To: 0x256}, - 92: {From: 0x210f, To: 0x21eb}, - 93: {From: 0x2135, To: 0x27d}, - 94: {From: 0x2160, To: 0x913}, - 95: {From: 0x2199, To: 0x121}, - 96: {From: 0x21ce, To: 0x1561}, - 97: {From: 0x21e6, To: 0x504}, - 98: {From: 0x21f4, To: 0x49f}, - 99: {From: 0x21fb, To: 0x269}, - 100: {From: 0x222d, To: 0x121}, - 101: {From: 0x2237, To: 0x121}, - 102: {From: 0x2248, To: 0x217d}, - 103: {From: 0x2262, To: 0x92a}, - 104: {From: 0x2316, To: 0x3226}, - 105: {From: 0x236a, To: 0x2835}, - 106: {From: 0x2382, To: 0x3365}, - 107: {From: 0x2472, To: 0x2c7}, - 108: {From: 0x24e4, To: 0x2ff}, - 109: {From: 0x24f0, To: 0x2fa}, - 110: {From: 0x24fa, To: 0x31f}, - 111: {From: 0x2550, To: 0xb5b}, - 112: {From: 0x25a9, To: 0xe2}, - 113: {From: 0x263e, To: 0x2d0}, - 114: {From: 0x26c9, To: 0x26b4}, - 115: {From: 0x26f9, To: 0x3c8}, - 116: {From: 0x2727, To: 0x3caf}, - 117: {From: 0x2755, To: 0x6a4}, - 118: {From: 0x2765, To: 0x26b4}, - 119: {From: 0x2789, To: 0x4358}, - 120: {From: 0x27c9, To: 0x2001}, - 121: {From: 0x28ea, To: 0x27b1}, - 122: {From: 0x28ef, To: 0x2837}, - 123: {From: 0x28fe, To: 0xaa5}, - 124: {From: 0x2914, To: 0x351}, - 125: {From: 0x2986, To: 0x2da7}, - 126: {From: 0x29f0, To: 0x96b}, - 127: {From: 0x2b1a, To: 0x38d}, - 128: {From: 0x2bfc, To: 0x395}, - 129: {From: 0x2c3f, To: 0x3caf}, - 130: {From: 0x2ce1, To: 0x2201}, - 131: {From: 0x2cfc, To: 0x3be}, - 132: {From: 0x2d13, To: 0x597}, - 133: {From: 0x2d47, To: 0x148}, - 134: {From: 0x2d48, To: 0x148}, - 135: {From: 0x2dff, To: 0x2f1}, - 136: {From: 0x2e08, To: 0x19cc}, - 137: {From: 0x2e10, To: 0xc45}, - 138: {From: 0x2e1a, To: 0x2d95}, - 139: {From: 0x2e21, To: 0x292}, - 140: {From: 0x2e54, To: 0x7d}, - 141: {From: 0x2e65, To: 0x2282}, - 142: {From: 0x2e97, To: 0x1a4}, - 143: {From: 0x2ea0, To: 0x2e9b}, - 144: {From: 0x2eef, To: 0x2ed7}, - 145: {From: 0x3193, To: 0x3c4}, - 146: {From: 0x3366, To: 0x338e}, - 147: {From: 0x342a, To: 0x3dc}, - 148: {From: 0x34ee, To: 0x18d0}, - 149: {From: 0x35c8, To: 0x2c9b}, - 150: {From: 0x35e6, To: 0x412}, - 151: {From: 0x35f5, To: 0x24b}, - 152: {From: 0x360d, To: 0x1dc}, - 153: {From: 0x3658, To: 0x246}, - 154: {From: 0x3676, To: 0x3f4}, - 155: {From: 0x36fd, To: 0x445}, - 156: {From: 0x3747, To: 0x3b42}, - 157: {From: 0x37c0, To: 0x121}, - 158: {From: 0x3816, To: 0x38f2}, - 159: {From: 0x382a, To: 0x2b48}, - 160: {From: 0x382b, To: 0x2c9b}, - 161: {From: 0x382f, To: 0xa9}, - 162: {From: 0x3832, To: 0x3228}, - 163: {From: 0x386c, To: 0x39a6}, - 164: {From: 0x3892, To: 0x3fc0}, - 165: {From: 0x38a0, To: 0x45f}, - 166: {From: 0x38a5, To: 0x39d7}, - 167: {From: 0x38b4, To: 0x1fa4}, - 168: {From: 0x38b5, To: 0x2e9a}, - 169: {From: 0x38fa, To: 0x38f1}, - 170: {From: 0x395c, To: 0x47e}, - 171: {From: 0x3b4e, To: 0xd91}, - 172: {From: 0x3b78, To: 0x137}, - 173: {From: 0x3c99, To: 0x4bc}, - 174: {From: 0x3fbd, To: 0x100}, - 175: {From: 0x4208, To: 0xa91}, - 176: {From: 0x42be, To: 0x573}, - 177: {From: 0x42f9, To: 0x3f60}, - 178: {From: 0x4378, To: 0x25a}, - 179: {From: 0x43b8, To: 0xe6c}, - 180: {From: 0x43cd, To: 0x10f}, - 181: {From: 0x43d4, To: 0x4848}, - 182: {From: 0x44af, To: 0x3322}, - 183: {From: 0x44e3, To: 0x512}, - 184: {From: 0x45ca, To: 0x2409}, - 185: {From: 0x45dd, To: 0x26dc}, - 186: {From: 0x4610, To: 0x48ae}, - 187: {From: 0x46ae, To: 0x46a0}, - 188: {From: 0x473e, To: 0x4745}, - 189: {From: 0x4817, To: 0x3503}, - 190: {From: 0x483b, To: 0x208b}, - 191: {From: 0x4916, To: 0x31f}, - 192: {From: 0x49a7, To: 0x523}, -} - -// Size: 193 bytes, 193 elements -var AliasTypes = [193]AliasType{ - // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, - 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, - 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, - 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, - // Entry 40 - 7F - 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, - 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, - 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, - // Entry 80 - BF - 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, - 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, - 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, - 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, - // Entry C0 - FF - 1, -} - -const ( - _Latn = 91 - _Hani = 57 - _Hans = 59 - _Hant = 60 - _Qaaa = 149 - _Qaai = 157 - _Qabx = 198 - _Zinh = 255 - _Zyyy = 260 - _Zzzz = 261 -) - -// script is an alphabetically sorted list of ISO 15924 codes. The index -// of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1052 bytes - "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + - "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + - "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + - "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + - "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + - "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + - "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + - "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + - "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + - "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + - "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + - "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + - "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + - "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" - -// suppressScript is an index from langID to the dominant script for that language, -// if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 1330 bytes, 1330 elements -var suppressScript = [1330]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 100 - 13F - 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, - // Entry 140 - 17F - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, - // Entry 200 - 23F - 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 280 - 2BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 2C0 - 2FF - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, - // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, - // Entry 3C0 - 3FF - 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 400 - 43F - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, - // Entry 480 - 4BF - 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 4C0 - 4FF - 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 500 - 53F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, - 0x00, 0x00, -} - -const ( - _001 = 1 - _419 = 31 - _BR = 65 - _CA = 73 - _ES = 111 - _GB = 124 - _MD = 189 - _PT = 239 - _UK = 307 - _US = 310 - _ZZ = 358 - _XA = 324 - _XC = 326 - _XK = 334 -) - -// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -// the UN.M49 codes used for groups.) -const isoRegionOffset = 32 - -// regionTypes defines the status of a region for various standards. -// Size: 359 bytes, 359 elements -var regionTypes = [359]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 40 - 7F - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, - 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 80 - BF - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry C0 - FF - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - // Entry 100 - 13F - 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - // Entry 140 - 17F - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, -} - -// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -// Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1312 bytes - "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + - "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + - "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + - "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + - "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + - "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + - "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + - "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + - "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + - "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + - "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + - "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + - "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + - "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + - "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + - "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + - "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + - "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + - "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" - -// altRegionISO3 holds a list of 3-letter region codes that cannot be -// mapped to 2-letter codes using the default algorithm. This is a short list. -const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" - -// altRegionIDs holds a list of regionIDs the positions of which match those -// of the 3-letter ISO codes in altRegionISO3. -// Size: 22 bytes, 11 elements -var altRegionIDs = [11]uint16{ - 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, - 0x0122, 0x0160, 0x00dd, -} - -// Size: 80 bytes, 20 elements -var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc5}, - 1: {From: 0x59, To: 0xa8}, - 2: {From: 0x60, To: 0x61}, - 3: {From: 0x67, To: 0x3b}, - 4: {From: 0x7a, To: 0x79}, - 5: {From: 0x94, To: 0x37}, - 6: {From: 0xa4, To: 0x134}, - 7: {From: 0xc2, To: 0x134}, - 8: {From: 0xd8, To: 0x140}, - 9: {From: 0xdd, To: 0x2b}, - 10: {From: 0xf0, To: 0x134}, - 11: {From: 0xf3, To: 0xe3}, - 12: {From: 0xfd, To: 0x71}, - 13: {From: 0x104, To: 0x165}, - 14: {From: 0x12b, To: 0x127}, - 15: {From: 0x133, To: 0x7c}, - 16: {From: 0x13b, To: 0x13f}, - 17: {From: 0x142, To: 0x134}, - 18: {From: 0x15e, To: 0x15f}, - 19: {From: 0x164, To: 0x4b}, -} - -// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -// codes indicating collections of regions. -// Size: 718 bytes, 359 elements -var m49 = [359]int16{ - // Entry 0 - 3F - 0, 1, 2, 3, 5, 9, 11, 13, - 14, 15, 17, 18, 19, 21, 29, 30, - 34, 35, 39, 53, 54, 57, 61, 142, - 143, 145, 150, 151, 154, 155, 202, 419, - 958, 0, 20, 784, 4, 28, 660, 8, - 51, 530, 24, 10, 32, 16, 40, 36, - 533, 248, 31, 70, 52, 50, 56, 854, - 100, 48, 108, 204, 652, 60, 96, 68, - // Entry 40 - 7F - 535, 76, 44, 64, 104, 74, 72, 112, - 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 0, 188, - 891, 296, 192, 132, 531, 162, 196, 203, - 278, 276, 0, 262, 208, 212, 214, 204, - 12, 0, 218, 233, 818, 732, 232, 724, - 231, 967, 0, 246, 242, 238, 583, 234, - 0, 250, 249, 266, 826, 308, 268, 254, - // Entry 80 - BF - 831, 288, 292, 304, 270, 324, 312, 226, - 300, 239, 320, 316, 624, 328, 344, 334, - 340, 191, 332, 348, 854, 0, 360, 372, - 376, 833, 356, 86, 368, 364, 352, 380, - 832, 388, 400, 392, 581, 404, 417, 116, - 296, 174, 659, 408, 410, 414, 136, 398, - 418, 422, 662, 438, 144, 430, 426, 440, - 442, 428, 434, 504, 492, 498, 499, 663, - // Entry C0 - FF - 450, 584, 581, 807, 466, 104, 496, 446, - 580, 474, 478, 500, 470, 480, 462, 454, - 484, 458, 508, 516, 540, 562, 574, 566, - 548, 558, 528, 578, 524, 10, 520, 536, - 570, 554, 512, 591, 0, 604, 258, 598, - 608, 586, 616, 666, 612, 630, 275, 620, - 581, 585, 600, 591, 634, 959, 960, 961, - 962, 963, 964, 965, 966, 967, 968, 969, - // Entry 100 - 13F - 970, 971, 972, 638, 716, 642, 688, 643, - 646, 682, 90, 690, 729, 752, 702, 654, - 705, 744, 703, 694, 674, 686, 706, 740, - 728, 678, 810, 222, 534, 760, 748, 0, - 796, 148, 260, 768, 764, 762, 772, 626, - 795, 788, 776, 626, 792, 780, 798, 158, - 834, 804, 800, 826, 581, 0, 840, 858, - 860, 336, 670, 704, 862, 92, 850, 704, - // Entry 140 - 17F - 548, 876, 581, 882, 973, 974, 975, 976, - 977, 978, 979, 980, 981, 982, 983, 984, - 985, 986, 987, 988, 989, 990, 991, 992, - 993, 994, 995, 996, 997, 998, 720, 887, - 175, 891, 710, 894, 180, 716, 999, -} - -// m49Index gives indexes into fromM49 based on the three most significant bits -// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -// -// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -// The region code is stored in the 9 lsb of the indexed value. -// Size: 18 bytes, 9 elements -var m49Index = [9]int16{ - 0, 59, 108, 143, 181, 220, 259, 291, - 333, -} - -// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. -// Size: 666 bytes, 333 elements -var fromM49 = [333]uint16{ - // Entry 0 - 3F - 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, - 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, - 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, - 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, - 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, - 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, - // Entry 40 - 7F - 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, - 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, - 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, - 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, - 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, - 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, - 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, - // Entry 80 - BF - 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, - 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, - 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, - 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, - 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, - 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, - 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, - 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, - // Entry C0 - FF - 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, - 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, - 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, - 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, - 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, - 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, - 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, - 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, - // Entry 100 - 13F - 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, - 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, - 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, - 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, - 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, - 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, - 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, - 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, - // Entry 140 - 17F - 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, - 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, -} - -// Size: 2128 bytes -var variantIndex = map[string]uint8{ - "1606nict": 0x0, - "1694acad": 0x1, - "1901": 0x2, - "1959acad": 0x3, - "1994": 0x67, - "1996": 0x4, - "abl1943": 0x5, - "akuapem": 0x6, - "alalc97": 0x69, - "aluku": 0x7, - "ao1990": 0x8, - "aranes": 0x9, - "arevela": 0xa, - "arevmda": 0xb, - "arkaika": 0xc, - "asante": 0xd, - "auvern": 0xe, - "baku1926": 0xf, - "balanka": 0x10, - "barla": 0x11, - "basiceng": 0x12, - "bauddha": 0x13, - "bciav": 0x14, - "bcizbl": 0x15, - "biscayan": 0x16, - "biske": 0x62, - "bohoric": 0x17, - "boont": 0x18, - "bornholm": 0x19, - "cisaup": 0x1a, - "colb1945": 0x1b, - "cornu": 0x1c, - "creiss": 0x1d, - "dajnko": 0x1e, - "ekavsk": 0x1f, - "emodeng": 0x20, - "fonipa": 0x6a, - "fonkirsh": 0x6b, - "fonnapa": 0x6c, - "fonupa": 0x6d, - "fonxsamp": 0x6e, - "gallo": 0x21, - "gascon": 0x22, - "grclass": 0x23, - "grital": 0x24, - "grmistr": 0x25, - "hepburn": 0x26, - "heploc": 0x68, - "hognorsk": 0x27, - "hsistemo": 0x28, - "ijekavsk": 0x29, - "itihasa": 0x2a, - "ivanchov": 0x2b, - "jauer": 0x2c, - "jyutping": 0x2d, - "kkcor": 0x2e, - "kociewie": 0x2f, - "kscor": 0x30, - "laukika": 0x31, - "lemosin": 0x32, - "lengadoc": 0x33, - "lipaw": 0x63, - "ltg1929": 0x34, - "ltg2007": 0x35, - "luna1918": 0x36, - "metelko": 0x37, - "monoton": 0x38, - "ndyuka": 0x39, - "nedis": 0x3a, - "newfound": 0x3b, - "nicard": 0x3c, - "njiva": 0x64, - "nulik": 0x3d, - "osojs": 0x65, - "oxendict": 0x3e, - "pahawh2": 0x3f, - "pahawh3": 0x40, - "pahawh4": 0x41, - "pamaka": 0x42, - "peano": 0x43, - "petr1708": 0x44, - "pinyin": 0x45, - "polyton": 0x46, - "provenc": 0x47, - "puter": 0x48, - "rigik": 0x49, - "rozaj": 0x4a, - "rumgr": 0x4b, - "scotland": 0x4c, - "scouse": 0x4d, - "simple": 0x6f, - "solba": 0x66, - "sotav": 0x4e, - "spanglis": 0x4f, - "surmiran": 0x50, - "sursilv": 0x51, - "sutsilv": 0x52, - "synnejyl": 0x53, - "tarask": 0x54, - "tongyong": 0x55, - "tunumiit": 0x56, - "uccor": 0x57, - "ucrcor": 0x58, - "ulster": 0x59, - "unifon": 0x5a, - "vaidika": 0x5b, - "valencia": 0x5c, - "vallader": 0x5d, - "vecdruka": 0x5e, - "vivaraup": 0x5f, - "wadegile": 0x60, - "xsistemo": 0x61, -} - -// variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 105 - -// nRegionGroups is the number of region groups. -const nRegionGroups = 33 - -type likelyLangRegion struct { - lang uint16 - region uint16 -} - -// likelyScript is a lookup table, indexed by scriptID, for the most likely -// languages and regions given a script. -// Size: 1052 bytes, 263 elements -var likelyScript = [263]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x85}, - 3: {lang: 0x2a2, region: 0x107}, - 4: {lang: 0x1f, region: 0x9a}, - 5: {lang: 0x3a, region: 0x6c}, - 7: {lang: 0x3b, region: 0x9d}, - 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9d}, - 10: {lang: 0x5b, region: 0x96}, - 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb5}, - 13: {lang: 0x63, region: 0x96}, - 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x9a}, - 17: {lang: 0x529, region: 0x12f}, - 18: {lang: 0x3b1, region: 0x9a}, - 19: {lang: 0x15e, region: 0x79}, - 20: {lang: 0xc2, region: 0x96}, - 21: {lang: 0x9d, region: 0xe8}, - 22: {lang: 0xdb, region: 0x35}, - 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12c}, - 25: {lang: 0xe7, region: 0x13f}, - 26: {lang: 0xe5, region: 0x136}, - 29: {lang: 0xf1, region: 0x6c}, - 31: {lang: 0x1a0, region: 0x5e}, - 32: {lang: 0x3e2, region: 0x107}, - 34: {lang: 0x1be, region: 0x9a}, - 38: {lang: 0x15e, region: 0x79}, - 41: {lang: 0x133, region: 0x6c}, - 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x70}, - 46: {lang: 0x210, region: 0x7e}, - 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x9a}, - 50: {lang: 0x19e, region: 0x131}, - 51: {lang: 0x3e9, region: 0x9a}, - 52: {lang: 0x136, region: 0x88}, - 53: {lang: 0x1a4, region: 0x9a}, - 54: {lang: 0x39d, region: 0x9a}, - 55: {lang: 0x529, region: 0x12f}, - 56: {lang: 0x254, region: 0xac}, - 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe8}, - 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12f}, - 61: {lang: 0x2fd, region: 0x9c}, - 62: {lang: 0x1bc, region: 0x98}, - 63: {lang: 0x200, region: 0xa3}, - 64: {lang: 0x1c5, region: 0x12c}, - 65: {lang: 0x1ca, region: 0xb0}, - 68: {lang: 0x1d5, region: 0x93}, - 70: {lang: 0x142, region: 0x9f}, - 71: {lang: 0x254, region: 0xac}, - 72: {lang: 0x20e, region: 0x96}, - 73: {lang: 0x200, region: 0xa3}, - 75: {lang: 0x135, region: 0xc5}, - 76: {lang: 0x200, region: 0xa3}, - 78: {lang: 0x3bb, region: 0xe9}, - 79: {lang: 0x24a, region: 0xa7}, - 80: {lang: 0x3fa, region: 0x9a}, - 83: {lang: 0x251, region: 0x9a}, - 84: {lang: 0x254, region: 0xac}, - 86: {lang: 0x88, region: 0x9a}, - 87: {lang: 0x370, region: 0x124}, - 88: {lang: 0x2b8, region: 0xb0}, - 93: {lang: 0x29f, region: 0x9a}, - 94: {lang: 0x2a8, region: 0x9a}, - 95: {lang: 0x28f, region: 0x88}, - 96: {lang: 0x1a0, region: 0x88}, - 97: {lang: 0x2ac, region: 0x53}, - 99: {lang: 0x4f4, region: 0x12c}, - 100: {lang: 0x4f5, region: 0x12c}, - 101: {lang: 0x1be, region: 0x9a}, - 103: {lang: 0x337, region: 0x9d}, - 104: {lang: 0x4f7, region: 0x53}, - 105: {lang: 0xa9, region: 0x53}, - 108: {lang: 0x2e8, region: 0x113}, - 109: {lang: 0x4f8, region: 0x10c}, - 110: {lang: 0x4f8, region: 0x10c}, - 111: {lang: 0x304, region: 0x9a}, - 112: {lang: 0x31b, region: 0x9a}, - 113: {lang: 0x30b, region: 0x53}, - 115: {lang: 0x31e, region: 0x35}, - 116: {lang: 0x30e, region: 0x9a}, - 117: {lang: 0x414, region: 0xe9}, - 118: {lang: 0x331, region: 0xc5}, - 121: {lang: 0x4f9, region: 0x109}, - 122: {lang: 0x3b, region: 0xa2}, - 123: {lang: 0x353, region: 0xdc}, - 126: {lang: 0x2d0, region: 0x85}, - 127: {lang: 0x52a, region: 0x53}, - 128: {lang: 0x403, region: 0x97}, - 129: {lang: 0x3ee, region: 0x9a}, - 130: {lang: 0x39b, region: 0xc6}, - 131: {lang: 0x395, region: 0x9a}, - 132: {lang: 0x399, region: 0x136}, - 133: {lang: 0x429, region: 0x116}, - 135: {lang: 0x3b, region: 0x11d}, - 136: {lang: 0xfd, region: 0xc5}, - 139: {lang: 0x27d, region: 0x107}, - 140: {lang: 0x2c9, region: 0x53}, - 141: {lang: 0x39f, region: 0x9d}, - 142: {lang: 0x39f, region: 0x53}, - 144: {lang: 0x3ad, region: 0xb1}, - 146: {lang: 0x1c6, region: 0x53}, - 147: {lang: 0x4fd, region: 0x9d}, - 200: {lang: 0x3cb, region: 0x96}, - 203: {lang: 0x372, region: 0x10d}, - 204: {lang: 0x420, region: 0x98}, - 206: {lang: 0x4ff, region: 0x15f}, - 207: {lang: 0x3f0, region: 0x9a}, - 208: {lang: 0x45, region: 0x136}, - 209: {lang: 0x139, region: 0x7c}, - 210: {lang: 0x3e9, region: 0x9a}, - 212: {lang: 0x3e9, region: 0x9a}, - 213: {lang: 0x3fa, region: 0x9a}, - 214: {lang: 0x40c, region: 0xb4}, - 217: {lang: 0x433, region: 0x9a}, - 218: {lang: 0xef, region: 0xc6}, - 219: {lang: 0x43e, region: 0x96}, - 221: {lang: 0x44d, region: 0x35}, - 222: {lang: 0x44e, region: 0x9c}, - 226: {lang: 0x45a, region: 0xe8}, - 227: {lang: 0x11a, region: 0x9a}, - 228: {lang: 0x45e, region: 0x53}, - 229: {lang: 0x232, region: 0x53}, - 230: {lang: 0x450, region: 0x9a}, - 231: {lang: 0x4a5, region: 0x53}, - 232: {lang: 0x9f, region: 0x13f}, - 233: {lang: 0x461, region: 0x9a}, - 235: {lang: 0x528, region: 0xbb}, - 236: {lang: 0x153, region: 0xe8}, - 237: {lang: 0x128, region: 0xce}, - 238: {lang: 0x46b, region: 0x124}, - 239: {lang: 0xa9, region: 0x53}, - 240: {lang: 0x2ce, region: 0x9a}, - 243: {lang: 0x4ad, region: 0x11d}, - 244: {lang: 0x4be, region: 0xb5}, - 247: {lang: 0x1ce, region: 0x9a}, - 250: {lang: 0x3a9, region: 0x9d}, - 251: {lang: 0x22, region: 0x9c}, - 253: {lang: 0x1ea, region: 0x53}, - 254: {lang: 0xef, region: 0xc6}, -} - -type likelyScriptRegion struct { - region uint16 - script uint16 - flags uint8 -} - -// likelyLang is a lookup table, indexed by langID, for the most likely -// scripts and regions given incomplete information. If more entries exist for a -// given language, region and script are the index and size respectively -// of the list in likelyLangList. -// Size: 7980 bytes, 1330 elements -var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x136, script: 0x5b, flags: 0x0}, - 1: {region: 0x70, script: 0x5b, flags: 0x0}, - 2: {region: 0x166, script: 0x5b, flags: 0x0}, - 3: {region: 0x166, script: 0x5b, flags: 0x0}, - 4: {region: 0x166, script: 0x5b, flags: 0x0}, - 5: {region: 0x7e, script: 0x20, flags: 0x0}, - 6: {region: 0x166, script: 0x5b, flags: 0x0}, - 7: {region: 0x166, script: 0x20, flags: 0x0}, - 8: {region: 0x81, script: 0x5b, flags: 0x0}, - 9: {region: 0x166, script: 0x5b, flags: 0x0}, - 10: {region: 0x166, script: 0x5b, flags: 0x0}, - 11: {region: 0x166, script: 0x5b, flags: 0x0}, - 12: {region: 0x96, script: 0x5b, flags: 0x0}, - 13: {region: 0x132, script: 0x5b, flags: 0x0}, - 14: {region: 0x81, script: 0x5b, flags: 0x0}, - 15: {region: 0x166, script: 0x5b, flags: 0x0}, - 16: {region: 0x166, script: 0x5b, flags: 0x0}, - 17: {region: 0x107, script: 0x20, flags: 0x0}, - 18: {region: 0x166, script: 0x5b, flags: 0x0}, - 19: {region: 0x9d, script: 0x9, flags: 0x0}, - 20: {region: 0x129, script: 0x5, flags: 0x0}, - 21: {region: 0x166, script: 0x5b, flags: 0x0}, - 22: {region: 0x162, script: 0x5b, flags: 0x0}, - 23: {region: 0x166, script: 0x5b, flags: 0x0}, - 24: {region: 0x166, script: 0x5b, flags: 0x0}, - 25: {region: 0x166, script: 0x5b, flags: 0x0}, - 26: {region: 0x166, script: 0x5b, flags: 0x0}, - 27: {region: 0x166, script: 0x5b, flags: 0x0}, - 28: {region: 0x52, script: 0x5b, flags: 0x0}, - 29: {region: 0x166, script: 0x5b, flags: 0x0}, - 30: {region: 0x166, script: 0x5b, flags: 0x0}, - 31: {region: 0x9a, script: 0x4, flags: 0x0}, - 32: {region: 0x166, script: 0x5b, flags: 0x0}, - 33: {region: 0x81, script: 0x5b, flags: 0x0}, - 34: {region: 0x9c, script: 0xfb, flags: 0x0}, - 35: {region: 0x166, script: 0x5b, flags: 0x0}, - 36: {region: 0x166, script: 0x5b, flags: 0x0}, - 37: {region: 0x14e, script: 0x5b, flags: 0x0}, - 38: {region: 0x107, script: 0x20, flags: 0x0}, - 39: {region: 0x70, script: 0x2c, flags: 0x0}, - 40: {region: 0x166, script: 0x5b, flags: 0x0}, - 41: {region: 0x166, script: 0x5b, flags: 0x0}, - 42: {region: 0xd7, script: 0x5b, flags: 0x0}, - 43: {region: 0x166, script: 0x5b, flags: 0x0}, - 45: {region: 0x166, script: 0x5b, flags: 0x0}, - 46: {region: 0x166, script: 0x5b, flags: 0x0}, - 47: {region: 0x166, script: 0x5b, flags: 0x0}, - 48: {region: 0x166, script: 0x5b, flags: 0x0}, - 49: {region: 0x166, script: 0x5b, flags: 0x0}, - 50: {region: 0x166, script: 0x5b, flags: 0x0}, - 51: {region: 0x96, script: 0x5b, flags: 0x0}, - 52: {region: 0x166, script: 0x5, flags: 0x0}, - 53: {region: 0x123, script: 0x5, flags: 0x0}, - 54: {region: 0x166, script: 0x5b, flags: 0x0}, - 55: {region: 0x166, script: 0x5b, flags: 0x0}, - 56: {region: 0x166, script: 0x5b, flags: 0x0}, - 57: {region: 0x166, script: 0x5b, flags: 0x0}, - 58: {region: 0x6c, script: 0x5, flags: 0x0}, - 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x166, script: 0x5b, flags: 0x0}, - 61: {region: 0x51, script: 0x5b, flags: 0x0}, - 62: {region: 0x3f, script: 0x5b, flags: 0x0}, - 63: {region: 0x68, script: 0x5, flags: 0x0}, - 65: {region: 0xbb, script: 0x5, flags: 0x0}, - 66: {region: 0x6c, script: 0x5, flags: 0x0}, - 67: {region: 0x9a, script: 0xe, flags: 0x0}, - 68: {region: 0x130, script: 0x5b, flags: 0x0}, - 69: {region: 0x136, script: 0xd0, flags: 0x0}, - 70: {region: 0x166, script: 0x5b, flags: 0x0}, - 71: {region: 0x166, script: 0x5b, flags: 0x0}, - 72: {region: 0x6f, script: 0x5b, flags: 0x0}, - 73: {region: 0x166, script: 0x5b, flags: 0x0}, - 74: {region: 0x166, script: 0x5b, flags: 0x0}, - 75: {region: 0x49, script: 0x5b, flags: 0x0}, - 76: {region: 0x166, script: 0x5b, flags: 0x0}, - 77: {region: 0x107, script: 0x20, flags: 0x0}, - 78: {region: 0x166, script: 0x5, flags: 0x0}, - 79: {region: 0x166, script: 0x5b, flags: 0x0}, - 80: {region: 0x166, script: 0x5b, flags: 0x0}, - 81: {region: 0x166, script: 0x5b, flags: 0x0}, - 82: {region: 0x9a, script: 0x22, flags: 0x0}, - 83: {region: 0x166, script: 0x5b, flags: 0x0}, - 84: {region: 0x166, script: 0x5b, flags: 0x0}, - 85: {region: 0x166, script: 0x5b, flags: 0x0}, - 86: {region: 0x3f, script: 0x5b, flags: 0x0}, - 87: {region: 0x166, script: 0x5b, flags: 0x0}, - 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x107, script: 0x20, flags: 0x0}, - 90: {region: 0xe9, script: 0x5, flags: 0x0}, - 91: {region: 0x96, script: 0x5b, flags: 0x0}, - 92: {region: 0xdc, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5b, flags: 0x0}, - 94: {region: 0x52, script: 0x5b, flags: 0x0}, - 95: {region: 0x166, script: 0x5b, flags: 0x0}, - 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x166, script: 0x5b, flags: 0x0}, - 98: {region: 0x166, script: 0x5b, flags: 0x0}, - 99: {region: 0x96, script: 0x5b, flags: 0x0}, - 100: {region: 0x166, script: 0x5b, flags: 0x0}, - 101: {region: 0x52, script: 0x5b, flags: 0x0}, - 102: {region: 0x166, script: 0x5b, flags: 0x0}, - 103: {region: 0x166, script: 0x5b, flags: 0x0}, - 104: {region: 0x166, script: 0x5b, flags: 0x0}, - 105: {region: 0x166, script: 0x5b, flags: 0x0}, - 106: {region: 0x4f, script: 0x5b, flags: 0x0}, - 107: {region: 0x166, script: 0x5b, flags: 0x0}, - 108: {region: 0x166, script: 0x5b, flags: 0x0}, - 109: {region: 0x166, script: 0x5b, flags: 0x0}, - 110: {region: 0x166, script: 0x2c, flags: 0x0}, - 111: {region: 0x166, script: 0x5b, flags: 0x0}, - 112: {region: 0x166, script: 0x5b, flags: 0x0}, - 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x166, script: 0x5b, flags: 0x0}, - 115: {region: 0x166, script: 0x5b, flags: 0x0}, - 116: {region: 0x10c, script: 0x5, flags: 0x0}, - 117: {region: 0x163, script: 0x5b, flags: 0x0}, - 118: {region: 0x166, script: 0x5b, flags: 0x0}, - 119: {region: 0x96, script: 0x5b, flags: 0x0}, - 120: {region: 0x166, script: 0x5b, flags: 0x0}, - 121: {region: 0x130, script: 0x5b, flags: 0x0}, - 122: {region: 0x52, script: 0x5b, flags: 0x0}, - 123: {region: 0x9a, script: 0xe6, flags: 0x0}, - 124: {region: 0xe9, script: 0x5, flags: 0x0}, - 125: {region: 0x9a, script: 0x22, flags: 0x0}, - 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x9a, script: 0x22, flags: 0x0}, - 128: {region: 0xe9, script: 0x5, flags: 0x0}, - 129: {region: 0x12c, script: 0x34, flags: 0x0}, - 131: {region: 0x9a, script: 0x22, flags: 0x0}, - 132: {region: 0x166, script: 0x5b, flags: 0x0}, - 133: {region: 0x9a, script: 0x22, flags: 0x0}, - 134: {region: 0xe8, script: 0x5b, flags: 0x0}, - 135: {region: 0x166, script: 0x5b, flags: 0x0}, - 136: {region: 0x9a, script: 0x22, flags: 0x0}, - 137: {region: 0x166, script: 0x5b, flags: 0x0}, - 138: {region: 0x140, script: 0x5b, flags: 0x0}, - 139: {region: 0x166, script: 0x5b, flags: 0x0}, - 140: {region: 0x166, script: 0x5b, flags: 0x0}, - 141: {region: 0xe8, script: 0x5b, flags: 0x0}, - 142: {region: 0x166, script: 0x5b, flags: 0x0}, - 143: {region: 0xd7, script: 0x5b, flags: 0x0}, - 144: {region: 0x166, script: 0x5b, flags: 0x0}, - 145: {region: 0x166, script: 0x5b, flags: 0x0}, - 146: {region: 0x166, script: 0x5b, flags: 0x0}, - 147: {region: 0x166, script: 0x2c, flags: 0x0}, - 148: {region: 0x9a, script: 0x22, flags: 0x0}, - 149: {region: 0x96, script: 0x5b, flags: 0x0}, - 150: {region: 0x166, script: 0x5b, flags: 0x0}, - 151: {region: 0x166, script: 0x5b, flags: 0x0}, - 152: {region: 0x115, script: 0x5b, flags: 0x0}, - 153: {region: 0x166, script: 0x5b, flags: 0x0}, - 154: {region: 0x166, script: 0x5b, flags: 0x0}, - 155: {region: 0x52, script: 0x5b, flags: 0x0}, - 156: {region: 0x166, script: 0x5b, flags: 0x0}, - 157: {region: 0xe8, script: 0x5b, flags: 0x0}, - 158: {region: 0x166, script: 0x5b, flags: 0x0}, - 159: {region: 0x13f, script: 0xe8, flags: 0x0}, - 160: {region: 0xc4, script: 0x5b, flags: 0x0}, - 161: {region: 0x166, script: 0x5b, flags: 0x0}, - 162: {region: 0x166, script: 0x5b, flags: 0x0}, - 163: {region: 0xc4, script: 0x5b, flags: 0x0}, - 164: {region: 0x166, script: 0x5b, flags: 0x0}, - 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x166, script: 0x5b, flags: 0x0}, - 167: {region: 0x166, script: 0x5b, flags: 0x0}, - 168: {region: 0x166, script: 0x5b, flags: 0x0}, - 169: {region: 0x53, script: 0xef, flags: 0x0}, - 170: {region: 0x166, script: 0x5b, flags: 0x0}, - 171: {region: 0x166, script: 0x5b, flags: 0x0}, - 172: {region: 0x166, script: 0x5b, flags: 0x0}, - 173: {region: 0x9a, script: 0xe, flags: 0x0}, - 174: {region: 0x166, script: 0x5b, flags: 0x0}, - 175: {region: 0x9d, script: 0x5, flags: 0x0}, - 176: {region: 0x166, script: 0x5b, flags: 0x0}, - 177: {region: 0x4f, script: 0x5b, flags: 0x0}, - 178: {region: 0x79, script: 0x5b, flags: 0x0}, - 179: {region: 0x9a, script: 0x22, flags: 0x0}, - 180: {region: 0xe9, script: 0x5, flags: 0x0}, - 181: {region: 0x9a, script: 0x22, flags: 0x0}, - 182: {region: 0x166, script: 0x5b, flags: 0x0}, - 183: {region: 0x33, script: 0x5b, flags: 0x0}, - 184: {region: 0x166, script: 0x5b, flags: 0x0}, - 185: {region: 0xb5, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5b, flags: 0x0}, - 187: {region: 0x166, script: 0x2c, flags: 0x0}, - 188: {region: 0xe8, script: 0x5b, flags: 0x0}, - 189: {region: 0x166, script: 0x5b, flags: 0x0}, - 190: {region: 0xe9, script: 0x22, flags: 0x0}, - 191: {region: 0x107, script: 0x20, flags: 0x0}, - 192: {region: 0x160, script: 0x5b, flags: 0x0}, - 193: {region: 0x166, script: 0x5b, flags: 0x0}, - 194: {region: 0x96, script: 0x5b, flags: 0x0}, - 195: {region: 0x166, script: 0x5b, flags: 0x0}, - 196: {region: 0x52, script: 0x5b, flags: 0x0}, - 197: {region: 0x166, script: 0x5b, flags: 0x0}, - 198: {region: 0x166, script: 0x5b, flags: 0x0}, - 199: {region: 0x166, script: 0x5b, flags: 0x0}, - 200: {region: 0x87, script: 0x5b, flags: 0x0}, - 201: {region: 0x166, script: 0x5b, flags: 0x0}, - 202: {region: 0x166, script: 0x5b, flags: 0x0}, - 203: {region: 0x166, script: 0x5b, flags: 0x0}, - 204: {region: 0x166, script: 0x5b, flags: 0x0}, - 205: {region: 0x6e, script: 0x2c, flags: 0x0}, - 206: {region: 0x166, script: 0x5b, flags: 0x0}, - 207: {region: 0x166, script: 0x5b, flags: 0x0}, - 208: {region: 0x52, script: 0x5b, flags: 0x0}, - 209: {region: 0x166, script: 0x5b, flags: 0x0}, - 210: {region: 0x166, script: 0x5b, flags: 0x0}, - 211: {region: 0xc4, script: 0x5b, flags: 0x0}, - 212: {region: 0x166, script: 0x5b, flags: 0x0}, - 213: {region: 0x166, script: 0x5b, flags: 0x0}, - 214: {region: 0x166, script: 0x5b, flags: 0x0}, - 215: {region: 0x6f, script: 0x5b, flags: 0x0}, - 216: {region: 0x166, script: 0x5b, flags: 0x0}, - 217: {region: 0x166, script: 0x5b, flags: 0x0}, - 218: {region: 0xd7, script: 0x5b, flags: 0x0}, - 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x107, script: 0x20, flags: 0x0}, - 221: {region: 0xe8, script: 0x5b, flags: 0x0}, - 222: {region: 0x166, script: 0x5b, flags: 0x0}, - 223: {region: 0x132, script: 0x5b, flags: 0x0}, - 224: {region: 0x8b, script: 0x5b, flags: 0x0}, - 225: {region: 0x76, script: 0x5b, flags: 0x0}, - 226: {region: 0x107, script: 0x20, flags: 0x0}, - 227: {region: 0x136, script: 0x5b, flags: 0x0}, - 228: {region: 0x49, script: 0x5b, flags: 0x0}, - 229: {region: 0x136, script: 0x1a, flags: 0x0}, - 230: {region: 0xa7, script: 0x5, flags: 0x0}, - 231: {region: 0x13f, script: 0x19, flags: 0x0}, - 232: {region: 0x166, script: 0x5b, flags: 0x0}, - 233: {region: 0x9c, script: 0x5, flags: 0x0}, - 234: {region: 0x166, script: 0x5b, flags: 0x0}, - 235: {region: 0x166, script: 0x5b, flags: 0x0}, - 236: {region: 0x166, script: 0x5b, flags: 0x0}, - 237: {region: 0x166, script: 0x5b, flags: 0x0}, - 238: {region: 0x166, script: 0x5b, flags: 0x0}, - 239: {region: 0xc6, script: 0xda, flags: 0x0}, - 240: {region: 0x79, script: 0x5b, flags: 0x0}, - 241: {region: 0x6c, script: 0x1d, flags: 0x0}, - 242: {region: 0xe8, script: 0x5b, flags: 0x0}, - 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x131, script: 0x20, flags: 0x0}, - 245: {region: 0x49, script: 0x17, flags: 0x0}, - 246: {region: 0x49, script: 0x17, flags: 0x0}, - 247: {region: 0x49, script: 0x17, flags: 0x0}, - 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10b, script: 0x5b, flags: 0x0}, - 250: {region: 0x5f, script: 0x5b, flags: 0x0}, - 251: {region: 0xea, script: 0x5b, flags: 0x0}, - 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc5, script: 0x88, flags: 0x0}, - 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x107, script: 0x20, flags: 0x0}, - 256: {region: 0x7c, script: 0x5b, flags: 0x0}, - 257: {region: 0x64, script: 0x5b, flags: 0x0}, - 258: {region: 0x166, script: 0x5b, flags: 0x0}, - 259: {region: 0x166, script: 0x5b, flags: 0x0}, - 260: {region: 0x166, script: 0x5b, flags: 0x0}, - 261: {region: 0x166, script: 0x5b, flags: 0x0}, - 262: {region: 0x136, script: 0x5b, flags: 0x0}, - 263: {region: 0x107, script: 0x20, flags: 0x0}, - 264: {region: 0xa5, script: 0x5b, flags: 0x0}, - 265: {region: 0x166, script: 0x5b, flags: 0x0}, - 266: {region: 0x166, script: 0x5b, flags: 0x0}, - 267: {region: 0x9a, script: 0x5, flags: 0x0}, - 268: {region: 0x166, script: 0x5b, flags: 0x0}, - 269: {region: 0x61, script: 0x5b, flags: 0x0}, - 270: {region: 0x166, script: 0x5b, flags: 0x0}, - 271: {region: 0x49, script: 0x5b, flags: 0x0}, - 272: {region: 0x166, script: 0x5b, flags: 0x0}, - 273: {region: 0x166, script: 0x5b, flags: 0x0}, - 274: {region: 0x166, script: 0x5b, flags: 0x0}, - 275: {region: 0x166, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5b, flags: 0x0}, - 277: {region: 0x166, script: 0x5b, flags: 0x0}, - 278: {region: 0x166, script: 0x5b, flags: 0x0}, - 279: {region: 0xd5, script: 0x5b, flags: 0x0}, - 280: {region: 0x4f, script: 0x5b, flags: 0x0}, - 281: {region: 0x166, script: 0x5b, flags: 0x0}, - 282: {region: 0x9a, script: 0x5, flags: 0x0}, - 283: {region: 0x166, script: 0x5b, flags: 0x0}, - 284: {region: 0x166, script: 0x5b, flags: 0x0}, - 285: {region: 0x166, script: 0x5b, flags: 0x0}, - 286: {region: 0x166, script: 0x2c, flags: 0x0}, - 287: {region: 0x61, script: 0x5b, flags: 0x0}, - 288: {region: 0xc4, script: 0x5b, flags: 0x0}, - 289: {region: 0xd1, script: 0x5b, flags: 0x0}, - 290: {region: 0x166, script: 0x5b, flags: 0x0}, - 291: {region: 0xdc, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5b, flags: 0x0}, - 293: {region: 0x166, script: 0x5b, flags: 0x0}, - 294: {region: 0x166, script: 0x5b, flags: 0x0}, - 295: {region: 0x166, script: 0x5b, flags: 0x0}, - 296: {region: 0xce, script: 0xed, flags: 0x0}, - 297: {region: 0x166, script: 0x5b, flags: 0x0}, - 298: {region: 0x166, script: 0x5b, flags: 0x0}, - 299: {region: 0x115, script: 0x5b, flags: 0x0}, - 300: {region: 0x37, script: 0x5b, flags: 0x0}, - 301: {region: 0x43, script: 0xef, flags: 0x0}, - 302: {region: 0x166, script: 0x5b, flags: 0x0}, - 303: {region: 0xa5, script: 0x5b, flags: 0x0}, - 304: {region: 0x81, script: 0x5b, flags: 0x0}, - 305: {region: 0xd7, script: 0x5b, flags: 0x0}, - 306: {region: 0x9f, script: 0x5b, flags: 0x0}, - 307: {region: 0x6c, script: 0x29, flags: 0x0}, - 308: {region: 0x166, script: 0x5b, flags: 0x0}, - 309: {region: 0xc5, script: 0x4b, flags: 0x0}, - 310: {region: 0x88, script: 0x34, flags: 0x0}, - 311: {region: 0x166, script: 0x5b, flags: 0x0}, - 312: {region: 0x166, script: 0x5b, flags: 0x0}, - 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x166, script: 0x5b, flags: 0x0}, - 315: {region: 0x166, script: 0x5b, flags: 0x0}, - 316: {region: 0x1, script: 0x5b, flags: 0x0}, - 317: {region: 0x166, script: 0x5b, flags: 0x0}, - 318: {region: 0x6f, script: 0x5b, flags: 0x0}, - 319: {region: 0x136, script: 0x5b, flags: 0x0}, - 320: {region: 0x6b, script: 0x5b, flags: 0x0}, - 321: {region: 0x166, script: 0x5b, flags: 0x0}, - 322: {region: 0x9f, script: 0x46, flags: 0x0}, - 323: {region: 0x166, script: 0x5b, flags: 0x0}, - 324: {region: 0x166, script: 0x5b, flags: 0x0}, - 325: {region: 0x6f, script: 0x5b, flags: 0x0}, - 326: {region: 0x52, script: 0x5b, flags: 0x0}, - 327: {region: 0x6f, script: 0x5b, flags: 0x0}, - 328: {region: 0x9d, script: 0x5, flags: 0x0}, - 329: {region: 0x166, script: 0x5b, flags: 0x0}, - 330: {region: 0x166, script: 0x5b, flags: 0x0}, - 331: {region: 0x166, script: 0x5b, flags: 0x0}, - 332: {region: 0x166, script: 0x5b, flags: 0x0}, - 333: {region: 0x87, script: 0x5b, flags: 0x0}, - 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x166, script: 0x5b, flags: 0x0}, - 336: {region: 0xc4, script: 0x5b, flags: 0x0}, - 337: {region: 0x73, script: 0x5b, flags: 0x0}, - 338: {region: 0x10c, script: 0x5, flags: 0x0}, - 339: {region: 0xe8, script: 0x5b, flags: 0x0}, - 340: {region: 0x10d, script: 0x5b, flags: 0x0}, - 341: {region: 0x74, script: 0x5b, flags: 0x0}, - 342: {region: 0x166, script: 0x5b, flags: 0x0}, - 343: {region: 0x166, script: 0x5b, flags: 0x0}, - 344: {region: 0x77, script: 0x5b, flags: 0x0}, - 345: {region: 0x166, script: 0x5b, flags: 0x0}, - 346: {region: 0x3b, script: 0x5b, flags: 0x0}, - 347: {region: 0x166, script: 0x5b, flags: 0x0}, - 348: {region: 0x166, script: 0x5b, flags: 0x0}, - 349: {region: 0x166, script: 0x5b, flags: 0x0}, - 350: {region: 0x79, script: 0x5b, flags: 0x0}, - 351: {region: 0x136, script: 0x5b, flags: 0x0}, - 352: {region: 0x79, script: 0x5b, flags: 0x0}, - 353: {region: 0x61, script: 0x5b, flags: 0x0}, - 354: {region: 0x61, script: 0x5b, flags: 0x0}, - 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x141, script: 0x5b, flags: 0x0}, - 357: {region: 0x166, script: 0x5b, flags: 0x0}, - 358: {region: 0x85, script: 0x5b, flags: 0x0}, - 359: {region: 0x166, script: 0x5b, flags: 0x0}, - 360: {region: 0xd5, script: 0x5b, flags: 0x0}, - 361: {region: 0x9f, script: 0x5b, flags: 0x0}, - 362: {region: 0xd7, script: 0x5b, flags: 0x0}, - 363: {region: 0x166, script: 0x5b, flags: 0x0}, - 364: {region: 0x10c, script: 0x5b, flags: 0x0}, - 365: {region: 0xda, script: 0x5b, flags: 0x0}, - 366: {region: 0x97, script: 0x5b, flags: 0x0}, - 367: {region: 0x81, script: 0x5b, flags: 0x0}, - 368: {region: 0x166, script: 0x5b, flags: 0x0}, - 369: {region: 0xbd, script: 0x5b, flags: 0x0}, - 370: {region: 0x166, script: 0x5b, flags: 0x0}, - 371: {region: 0x166, script: 0x5b, flags: 0x0}, - 372: {region: 0x166, script: 0x5b, flags: 0x0}, - 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x166, script: 0x5b, flags: 0x0}, - 375: {region: 0x96, script: 0x5b, flags: 0x0}, - 376: {region: 0x166, script: 0x5b, flags: 0x0}, - 377: {region: 0x166, script: 0x5b, flags: 0x0}, - 378: {region: 0x9a, script: 0x22, flags: 0x0}, - 379: {region: 0x166, script: 0x5b, flags: 0x0}, - 380: {region: 0x9d, script: 0x5, flags: 0x0}, - 381: {region: 0x7f, script: 0x5b, flags: 0x0}, - 382: {region: 0x7c, script: 0x5b, flags: 0x0}, - 383: {region: 0x166, script: 0x5b, flags: 0x0}, - 384: {region: 0x166, script: 0x5b, flags: 0x0}, - 385: {region: 0x166, script: 0x5b, flags: 0x0}, - 386: {region: 0x166, script: 0x5b, flags: 0x0}, - 387: {region: 0x166, script: 0x5b, flags: 0x0}, - 388: {region: 0x166, script: 0x5b, flags: 0x0}, - 389: {region: 0x70, script: 0x2c, flags: 0x0}, - 390: {region: 0x166, script: 0x5b, flags: 0x0}, - 391: {region: 0xdc, script: 0x22, flags: 0x0}, - 392: {region: 0x166, script: 0x5b, flags: 0x0}, - 393: {region: 0xa8, script: 0x5b, flags: 0x0}, - 394: {region: 0x166, script: 0x5b, flags: 0x0}, - 395: {region: 0xe9, script: 0x5, flags: 0x0}, - 396: {region: 0x166, script: 0x5b, flags: 0x0}, - 397: {region: 0xe9, script: 0x5, flags: 0x0}, - 398: {region: 0x166, script: 0x5b, flags: 0x0}, - 399: {region: 0x166, script: 0x5b, flags: 0x0}, - 400: {region: 0x6f, script: 0x5b, flags: 0x0}, - 401: {region: 0x9d, script: 0x5, flags: 0x0}, - 402: {region: 0x166, script: 0x5b, flags: 0x0}, - 403: {region: 0x166, script: 0x2c, flags: 0x0}, - 404: {region: 0xf2, script: 0x5b, flags: 0x0}, - 405: {region: 0x166, script: 0x5b, flags: 0x0}, - 406: {region: 0x166, script: 0x5b, flags: 0x0}, - 407: {region: 0x166, script: 0x5b, flags: 0x0}, - 408: {region: 0x166, script: 0x2c, flags: 0x0}, - 409: {region: 0x166, script: 0x5b, flags: 0x0}, - 410: {region: 0x9a, script: 0x22, flags: 0x0}, - 411: {region: 0x9a, script: 0xe9, flags: 0x0}, - 412: {region: 0x96, script: 0x5b, flags: 0x0}, - 413: {region: 0xda, script: 0x5b, flags: 0x0}, - 414: {region: 0x131, script: 0x32, flags: 0x0}, - 415: {region: 0x166, script: 0x5b, flags: 0x0}, - 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x9a, script: 0xe, flags: 0x0}, - 418: {region: 0x166, script: 0x5b, flags: 0x0}, - 419: {region: 0x4e, script: 0x5b, flags: 0x0}, - 420: {region: 0x9a, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5b, flags: 0x0}, - 422: {region: 0x54, script: 0x5b, flags: 0x0}, - 423: {region: 0x166, script: 0x5b, flags: 0x0}, - 424: {region: 0x81, script: 0x5b, flags: 0x0}, - 425: {region: 0x166, script: 0x5b, flags: 0x0}, - 426: {region: 0x166, script: 0x5b, flags: 0x0}, - 427: {region: 0xa5, script: 0x5b, flags: 0x0}, - 428: {region: 0x99, script: 0x5b, flags: 0x0}, - 429: {region: 0x166, script: 0x5b, flags: 0x0}, - 430: {region: 0xdc, script: 0x22, flags: 0x0}, - 431: {region: 0x166, script: 0x5b, flags: 0x0}, - 432: {region: 0x166, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5b, flags: 0x0}, - 434: {region: 0x166, script: 0x5, flags: 0x0}, - 435: {region: 0x166, script: 0x5b, flags: 0x0}, - 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x166, script: 0x5b, flags: 0x0}, - 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x166, script: 0x5b, flags: 0x0}, - 440: {region: 0x136, script: 0x5b, flags: 0x0}, - 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x166, script: 0x5b, flags: 0x0}, - 443: {region: 0x166, script: 0x2c, flags: 0x0}, - 444: {region: 0x98, script: 0x3e, flags: 0x0}, - 445: {region: 0x166, script: 0x5b, flags: 0x0}, - 446: {region: 0x9a, script: 0x22, flags: 0x0}, - 447: {region: 0x166, script: 0x5b, flags: 0x0}, - 448: {region: 0x74, script: 0x5b, flags: 0x0}, - 449: {region: 0x166, script: 0x5b, flags: 0x0}, - 450: {region: 0x166, script: 0x5b, flags: 0x0}, - 451: {region: 0xe8, script: 0x5b, flags: 0x0}, - 452: {region: 0x166, script: 0x5b, flags: 0x0}, - 453: {region: 0x12c, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x92, flags: 0x0}, - 455: {region: 0x166, script: 0x5b, flags: 0x0}, - 456: {region: 0xe9, script: 0x5, flags: 0x0}, - 457: {region: 0x9a, script: 0x22, flags: 0x0}, - 458: {region: 0xb0, script: 0x41, flags: 0x0}, - 459: {region: 0xe8, script: 0x5b, flags: 0x0}, - 460: {region: 0xe9, script: 0x5, flags: 0x0}, - 461: {region: 0xe7, script: 0x5b, flags: 0x0}, - 462: {region: 0x9a, script: 0x22, flags: 0x0}, - 463: {region: 0x9a, script: 0x22, flags: 0x0}, - 464: {region: 0x166, script: 0x5b, flags: 0x0}, - 465: {region: 0x91, script: 0x5b, flags: 0x0}, - 466: {region: 0x61, script: 0x5b, flags: 0x0}, - 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x92, script: 0x5b, flags: 0x0}, - 469: {region: 0x93, script: 0x5b, flags: 0x0}, - 470: {region: 0x166, script: 0x5b, flags: 0x0}, - 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd3, script: 0x5b, flags: 0x0}, - 473: {region: 0x79, script: 0x5b, flags: 0x0}, - 474: {region: 0x166, script: 0x5b, flags: 0x0}, - 475: {region: 0x166, script: 0x5b, flags: 0x0}, - 476: {region: 0xd1, script: 0x5b, flags: 0x0}, - 477: {region: 0xd7, script: 0x5b, flags: 0x0}, - 478: {region: 0x166, script: 0x5b, flags: 0x0}, - 479: {region: 0x166, script: 0x5b, flags: 0x0}, - 480: {region: 0x166, script: 0x5b, flags: 0x0}, - 481: {region: 0x96, script: 0x5b, flags: 0x0}, - 482: {region: 0x166, script: 0x5b, flags: 0x0}, - 483: {region: 0x166, script: 0x5b, flags: 0x0}, - 484: {region: 0x166, script: 0x5b, flags: 0x0}, - 486: {region: 0x123, script: 0x5b, flags: 0x0}, - 487: {region: 0xd7, script: 0x5b, flags: 0x0}, - 488: {region: 0x166, script: 0x5b, flags: 0x0}, - 489: {region: 0x166, script: 0x5b, flags: 0x0}, - 490: {region: 0x53, script: 0xfd, flags: 0x0}, - 491: {region: 0x166, script: 0x5b, flags: 0x0}, - 492: {region: 0x136, script: 0x5b, flags: 0x0}, - 493: {region: 0x166, script: 0x5b, flags: 0x0}, - 494: {region: 0x49, script: 0x5b, flags: 0x0}, - 495: {region: 0x166, script: 0x5b, flags: 0x0}, - 496: {region: 0x166, script: 0x5b, flags: 0x0}, - 497: {region: 0xe8, script: 0x5b, flags: 0x0}, - 498: {region: 0x166, script: 0x5b, flags: 0x0}, - 499: {region: 0x96, script: 0x5b, flags: 0x0}, - 500: {region: 0x107, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5b, flags: 0x0}, - 502: {region: 0x166, script: 0x5b, flags: 0x0}, - 503: {region: 0x166, script: 0x5b, flags: 0x0}, - 504: {region: 0x9e, script: 0x5b, flags: 0x0}, - 505: {region: 0x9f, script: 0x5b, flags: 0x0}, - 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x98, script: 0x3e, flags: 0x0}, - 508: {region: 0x166, script: 0x5b, flags: 0x0}, - 509: {region: 0x166, script: 0x5b, flags: 0x0}, - 510: {region: 0x107, script: 0x5b, flags: 0x0}, - 511: {region: 0x166, script: 0x5b, flags: 0x0}, - 512: {region: 0xa3, script: 0x49, flags: 0x0}, - 513: {region: 0x166, script: 0x5b, flags: 0x0}, - 514: {region: 0xa1, script: 0x5b, flags: 0x0}, - 515: {region: 0x1, script: 0x5b, flags: 0x0}, - 516: {region: 0x166, script: 0x5b, flags: 0x0}, - 517: {region: 0x166, script: 0x5b, flags: 0x0}, - 518: {region: 0x166, script: 0x5b, flags: 0x0}, - 519: {region: 0x52, script: 0x5b, flags: 0x0}, - 520: {region: 0x131, script: 0x3e, flags: 0x0}, - 521: {region: 0x166, script: 0x5b, flags: 0x0}, - 522: {region: 0x130, script: 0x5b, flags: 0x0}, - 523: {region: 0xdc, script: 0x22, flags: 0x0}, - 524: {region: 0x166, script: 0x5b, flags: 0x0}, - 525: {region: 0x64, script: 0x5b, flags: 0x0}, - 526: {region: 0x96, script: 0x5b, flags: 0x0}, - 527: {region: 0x96, script: 0x5b, flags: 0x0}, - 528: {region: 0x7e, script: 0x2e, flags: 0x0}, - 529: {region: 0x138, script: 0x20, flags: 0x0}, - 530: {region: 0x68, script: 0x5b, flags: 0x0}, - 531: {region: 0xc5, script: 0x5b, flags: 0x0}, - 532: {region: 0x166, script: 0x5b, flags: 0x0}, - 533: {region: 0x166, script: 0x5b, flags: 0x0}, - 534: {region: 0xd7, script: 0x5b, flags: 0x0}, - 535: {region: 0xa5, script: 0x5b, flags: 0x0}, - 536: {region: 0xc4, script: 0x5b, flags: 0x0}, - 537: {region: 0x107, script: 0x20, flags: 0x0}, - 538: {region: 0x166, script: 0x5b, flags: 0x0}, - 539: {region: 0x166, script: 0x5b, flags: 0x0}, - 540: {region: 0x166, script: 0x5b, flags: 0x0}, - 541: {region: 0x166, script: 0x5b, flags: 0x0}, - 542: {region: 0xd5, script: 0x5, flags: 0x0}, - 543: {region: 0xd7, script: 0x5b, flags: 0x0}, - 544: {region: 0x165, script: 0x5b, flags: 0x0}, - 545: {region: 0x166, script: 0x5b, flags: 0x0}, - 546: {region: 0x166, script: 0x5b, flags: 0x0}, - 547: {region: 0x130, script: 0x5b, flags: 0x0}, - 548: {region: 0x123, script: 0x5, flags: 0x0}, - 549: {region: 0x166, script: 0x5b, flags: 0x0}, - 550: {region: 0x124, script: 0xee, flags: 0x0}, - 551: {region: 0x5b, script: 0x5b, flags: 0x0}, - 552: {region: 0x52, script: 0x5b, flags: 0x0}, - 553: {region: 0x166, script: 0x5b, flags: 0x0}, - 554: {region: 0x4f, script: 0x5b, flags: 0x0}, - 555: {region: 0x9a, script: 0x22, flags: 0x0}, - 556: {region: 0x9a, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5b, flags: 0x0}, - 558: {region: 0x96, script: 0x5b, flags: 0x0}, - 559: {region: 0x166, script: 0x5b, flags: 0x0}, - 560: {region: 0x41, script: 0x5b, flags: 0x0}, - 561: {region: 0x9a, script: 0x5b, flags: 0x0}, - 562: {region: 0x53, script: 0xe5, flags: 0x0}, - 563: {region: 0x9a, script: 0x22, flags: 0x0}, - 564: {region: 0xc4, script: 0x5b, flags: 0x0}, - 565: {region: 0x166, script: 0x5b, flags: 0x0}, - 566: {region: 0x9a, script: 0x76, flags: 0x0}, - 567: {region: 0xe9, script: 0x5, flags: 0x0}, - 568: {region: 0x166, script: 0x5b, flags: 0x0}, - 569: {region: 0xa5, script: 0x5b, flags: 0x0}, - 570: {region: 0x166, script: 0x5b, flags: 0x0}, - 571: {region: 0x12c, script: 0x5b, flags: 0x0}, - 572: {region: 0x166, script: 0x5b, flags: 0x0}, - 573: {region: 0xd3, script: 0x5b, flags: 0x0}, - 574: {region: 0x166, script: 0x5b, flags: 0x0}, - 575: {region: 0xb0, script: 0x58, flags: 0x0}, - 576: {region: 0x166, script: 0x5b, flags: 0x0}, - 577: {region: 0x166, script: 0x5b, flags: 0x0}, - 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x166, script: 0x5b, flags: 0x0}, - 580: {region: 0x52, script: 0x5b, flags: 0x0}, - 581: {region: 0x83, script: 0x5b, flags: 0x0}, - 582: {region: 0xa5, script: 0x5b, flags: 0x0}, - 583: {region: 0x166, script: 0x5b, flags: 0x0}, - 584: {region: 0x166, script: 0x5b, flags: 0x0}, - 585: {region: 0x166, script: 0x5b, flags: 0x0}, - 586: {region: 0xa7, script: 0x4f, flags: 0x0}, - 587: {region: 0x2a, script: 0x5b, flags: 0x0}, - 588: {region: 0x166, script: 0x5b, flags: 0x0}, - 589: {region: 0x166, script: 0x5b, flags: 0x0}, - 590: {region: 0x166, script: 0x5b, flags: 0x0}, - 591: {region: 0x166, script: 0x5b, flags: 0x0}, - 592: {region: 0x166, script: 0x5b, flags: 0x0}, - 593: {region: 0x9a, script: 0x53, flags: 0x0}, - 594: {region: 0x8c, script: 0x5b, flags: 0x0}, - 595: {region: 0x166, script: 0x5b, flags: 0x0}, - 596: {region: 0xac, script: 0x54, flags: 0x0}, - 597: {region: 0x107, script: 0x20, flags: 0x0}, - 598: {region: 0x9a, script: 0x22, flags: 0x0}, - 599: {region: 0x166, script: 0x5b, flags: 0x0}, - 600: {region: 0x76, script: 0x5b, flags: 0x0}, - 601: {region: 0x166, script: 0x5b, flags: 0x0}, - 602: {region: 0xb5, script: 0x5b, flags: 0x0}, - 603: {region: 0x166, script: 0x5b, flags: 0x0}, - 604: {region: 0x166, script: 0x5b, flags: 0x0}, - 605: {region: 0x166, script: 0x5b, flags: 0x0}, - 606: {region: 0x166, script: 0x5b, flags: 0x0}, - 607: {region: 0x166, script: 0x5b, flags: 0x0}, - 608: {region: 0x166, script: 0x5b, flags: 0x0}, - 609: {region: 0x166, script: 0x5b, flags: 0x0}, - 610: {region: 0x166, script: 0x2c, flags: 0x0}, - 611: {region: 0x166, script: 0x5b, flags: 0x0}, - 612: {region: 0x107, script: 0x20, flags: 0x0}, - 613: {region: 0x113, script: 0x5b, flags: 0x0}, - 614: {region: 0xe8, script: 0x5b, flags: 0x0}, - 615: {region: 0x107, script: 0x5b, flags: 0x0}, - 616: {region: 0x166, script: 0x5b, flags: 0x0}, - 617: {region: 0x9a, script: 0x22, flags: 0x0}, - 618: {region: 0x9a, script: 0x5, flags: 0x0}, - 619: {region: 0x130, script: 0x5b, flags: 0x0}, - 620: {region: 0x166, script: 0x5b, flags: 0x0}, - 621: {region: 0x52, script: 0x5b, flags: 0x0}, - 622: {region: 0x61, script: 0x5b, flags: 0x0}, - 623: {region: 0x166, script: 0x5b, flags: 0x0}, - 624: {region: 0x166, script: 0x5b, flags: 0x0}, - 625: {region: 0x166, script: 0x2c, flags: 0x0}, - 626: {region: 0x166, script: 0x5b, flags: 0x0}, - 627: {region: 0x166, script: 0x5b, flags: 0x0}, - 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x166, script: 0x5b, flags: 0x0}, - 630: {region: 0x166, script: 0x5b, flags: 0x0}, - 631: {region: 0x166, script: 0x5b, flags: 0x0}, - 632: {region: 0x166, script: 0x5b, flags: 0x0}, - 633: {region: 0x107, script: 0x20, flags: 0x0}, - 634: {region: 0x166, script: 0x5b, flags: 0x0}, - 635: {region: 0x166, script: 0x5b, flags: 0x0}, - 636: {region: 0x166, script: 0x5b, flags: 0x0}, - 637: {region: 0x107, script: 0x20, flags: 0x0}, - 638: {region: 0x166, script: 0x5b, flags: 0x0}, - 639: {region: 0x96, script: 0x5b, flags: 0x0}, - 640: {region: 0xe9, script: 0x5, flags: 0x0}, - 641: {region: 0x7c, script: 0x5b, flags: 0x0}, - 642: {region: 0x166, script: 0x5b, flags: 0x0}, - 643: {region: 0x166, script: 0x5b, flags: 0x0}, - 644: {region: 0x166, script: 0x5b, flags: 0x0}, - 645: {region: 0x166, script: 0x2c, flags: 0x0}, - 646: {region: 0x124, script: 0xee, flags: 0x0}, - 647: {region: 0xe9, script: 0x5, flags: 0x0}, - 648: {region: 0x166, script: 0x5b, flags: 0x0}, - 649: {region: 0x166, script: 0x5b, flags: 0x0}, - 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x166, script: 0x5b, flags: 0x0}, - 652: {region: 0x166, script: 0x5b, flags: 0x0}, - 653: {region: 0x166, script: 0x5b, flags: 0x0}, - 654: {region: 0x139, script: 0x5b, flags: 0x0}, - 655: {region: 0x88, script: 0x5f, flags: 0x0}, - 656: {region: 0x98, script: 0x3e, flags: 0x0}, - 657: {region: 0x130, script: 0x5b, flags: 0x0}, - 658: {region: 0xe9, script: 0x5, flags: 0x0}, - 659: {region: 0x132, script: 0x5b, flags: 0x0}, - 660: {region: 0x166, script: 0x5b, flags: 0x0}, - 661: {region: 0xb8, script: 0x5b, flags: 0x0}, - 662: {region: 0x107, script: 0x20, flags: 0x0}, - 663: {region: 0x166, script: 0x5b, flags: 0x0}, - 664: {region: 0x96, script: 0x5b, flags: 0x0}, - 665: {region: 0x166, script: 0x5b, flags: 0x0}, - 666: {region: 0x53, script: 0xee, flags: 0x0}, - 667: {region: 0x166, script: 0x5b, flags: 0x0}, - 668: {region: 0x166, script: 0x5b, flags: 0x0}, - 669: {region: 0x166, script: 0x5b, flags: 0x0}, - 670: {region: 0x166, script: 0x5b, flags: 0x0}, - 671: {region: 0x9a, script: 0x5d, flags: 0x0}, - 672: {region: 0x166, script: 0x5b, flags: 0x0}, - 673: {region: 0x166, script: 0x5b, flags: 0x0}, - 674: {region: 0x107, script: 0x20, flags: 0x0}, - 675: {region: 0x132, script: 0x5b, flags: 0x0}, - 676: {region: 0x166, script: 0x5b, flags: 0x0}, - 677: {region: 0xda, script: 0x5b, flags: 0x0}, - 678: {region: 0x166, script: 0x5b, flags: 0x0}, - 679: {region: 0x166, script: 0x5b, flags: 0x0}, - 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x166, script: 0x5b, flags: 0x0}, - 682: {region: 0x166, script: 0x5b, flags: 0x0}, - 683: {region: 0x9f, script: 0x5b, flags: 0x0}, - 684: {region: 0x53, script: 0x61, flags: 0x0}, - 685: {region: 0x96, script: 0x5b, flags: 0x0}, - 686: {region: 0x9d, script: 0x5, flags: 0x0}, - 687: {region: 0x136, script: 0x5b, flags: 0x0}, - 688: {region: 0x166, script: 0x5b, flags: 0x0}, - 689: {region: 0x166, script: 0x5b, flags: 0x0}, - 690: {region: 0x9a, script: 0xe9, flags: 0x0}, - 691: {region: 0x9f, script: 0x5b, flags: 0x0}, - 692: {region: 0x166, script: 0x5b, flags: 0x0}, - 693: {region: 0x4b, script: 0x5b, flags: 0x0}, - 694: {region: 0x166, script: 0x5b, flags: 0x0}, - 695: {region: 0x166, script: 0x5b, flags: 0x0}, - 696: {region: 0xb0, script: 0x58, flags: 0x0}, - 697: {region: 0x166, script: 0x5b, flags: 0x0}, - 698: {region: 0x166, script: 0x5b, flags: 0x0}, - 699: {region: 0x4b, script: 0x5b, flags: 0x0}, - 700: {region: 0x166, script: 0x5b, flags: 0x0}, - 701: {region: 0x166, script: 0x5b, flags: 0x0}, - 702: {region: 0x163, script: 0x5b, flags: 0x0}, - 703: {region: 0x9d, script: 0x5, flags: 0x0}, - 704: {region: 0xb7, script: 0x5b, flags: 0x0}, - 705: {region: 0xb9, script: 0x5b, flags: 0x0}, - 706: {region: 0x4b, script: 0x5b, flags: 0x0}, - 707: {region: 0x4b, script: 0x5b, flags: 0x0}, - 708: {region: 0xa5, script: 0x5b, flags: 0x0}, - 709: {region: 0xa5, script: 0x5b, flags: 0x0}, - 710: {region: 0x9d, script: 0x5, flags: 0x0}, - 711: {region: 0xb9, script: 0x5b, flags: 0x0}, - 712: {region: 0x124, script: 0xee, flags: 0x0}, - 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12c, script: 0x5b, flags: 0x0}, - 715: {region: 0x96, script: 0x5b, flags: 0x0}, - 716: {region: 0x52, script: 0x5b, flags: 0x0}, - 717: {region: 0x9a, script: 0x22, flags: 0x0}, - 718: {region: 0x9a, script: 0x22, flags: 0x0}, - 719: {region: 0x96, script: 0x5b, flags: 0x0}, - 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa5, script: 0x5b, flags: 0x0}, - 722: {region: 0x166, script: 0x5b, flags: 0x0}, - 723: {region: 0xd0, script: 0x5b, flags: 0x0}, - 724: {region: 0x166, script: 0x5b, flags: 0x0}, - 725: {region: 0x166, script: 0x5b, flags: 0x0}, - 726: {region: 0x166, script: 0x5b, flags: 0x0}, - 727: {region: 0x166, script: 0x5b, flags: 0x0}, - 728: {region: 0x166, script: 0x5b, flags: 0x0}, - 729: {region: 0x166, script: 0x5b, flags: 0x0}, - 730: {region: 0x166, script: 0x5b, flags: 0x0}, - 731: {region: 0x166, script: 0x5b, flags: 0x0}, - 732: {region: 0x166, script: 0x5b, flags: 0x0}, - 733: {region: 0x166, script: 0x5b, flags: 0x0}, - 734: {region: 0x166, script: 0x5b, flags: 0x0}, - 735: {region: 0x166, script: 0x5, flags: 0x0}, - 736: {region: 0x107, script: 0x20, flags: 0x0}, - 737: {region: 0xe8, script: 0x5b, flags: 0x0}, - 738: {region: 0x166, script: 0x5b, flags: 0x0}, - 739: {region: 0x96, script: 0x5b, flags: 0x0}, - 740: {region: 0x166, script: 0x2c, flags: 0x0}, - 741: {region: 0x166, script: 0x5b, flags: 0x0}, - 742: {region: 0x166, script: 0x5b, flags: 0x0}, - 743: {region: 0x166, script: 0x5b, flags: 0x0}, - 744: {region: 0x113, script: 0x5b, flags: 0x0}, - 745: {region: 0xa5, script: 0x5b, flags: 0x0}, - 746: {region: 0x166, script: 0x5b, flags: 0x0}, - 747: {region: 0x166, script: 0x5b, flags: 0x0}, - 748: {region: 0x124, script: 0x5, flags: 0x0}, - 749: {region: 0xcd, script: 0x5b, flags: 0x0}, - 750: {region: 0x166, script: 0x5b, flags: 0x0}, - 751: {region: 0x166, script: 0x5b, flags: 0x0}, - 752: {region: 0x166, script: 0x5b, flags: 0x0}, - 753: {region: 0xc0, script: 0x5b, flags: 0x0}, - 754: {region: 0xd2, script: 0x5b, flags: 0x0}, - 755: {region: 0x166, script: 0x5b, flags: 0x0}, - 756: {region: 0x52, script: 0x5b, flags: 0x0}, - 757: {region: 0xdc, script: 0x22, flags: 0x0}, - 758: {region: 0x130, script: 0x5b, flags: 0x0}, - 759: {region: 0xc1, script: 0x5b, flags: 0x0}, - 760: {region: 0x166, script: 0x5b, flags: 0x0}, - 761: {region: 0x166, script: 0x5b, flags: 0x0}, - 762: {region: 0xe1, script: 0x5b, flags: 0x0}, - 763: {region: 0x166, script: 0x5b, flags: 0x0}, - 764: {region: 0x96, script: 0x5b, flags: 0x0}, - 765: {region: 0x9c, script: 0x3d, flags: 0x0}, - 766: {region: 0x166, script: 0x5b, flags: 0x0}, - 767: {region: 0xc3, script: 0x20, flags: 0x0}, - 768: {region: 0x166, script: 0x5, flags: 0x0}, - 769: {region: 0x166, script: 0x5b, flags: 0x0}, - 770: {region: 0x166, script: 0x5b, flags: 0x0}, - 771: {region: 0x166, script: 0x5b, flags: 0x0}, - 772: {region: 0x9a, script: 0x6f, flags: 0x0}, - 773: {region: 0x166, script: 0x5b, flags: 0x0}, - 774: {region: 0x166, script: 0x5b, flags: 0x0}, - 775: {region: 0x10c, script: 0x5b, flags: 0x0}, - 776: {region: 0x166, script: 0x5b, flags: 0x0}, - 777: {region: 0x166, script: 0x5b, flags: 0x0}, - 778: {region: 0x166, script: 0x5b, flags: 0x0}, - 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x166, script: 0x5b, flags: 0x0}, - 781: {region: 0x166, script: 0x5b, flags: 0x0}, - 782: {region: 0x9a, script: 0xe, flags: 0x0}, - 783: {region: 0xc5, script: 0x76, flags: 0x0}, - 785: {region: 0x166, script: 0x5b, flags: 0x0}, - 786: {region: 0x49, script: 0x5b, flags: 0x0}, - 787: {region: 0x49, script: 0x5b, flags: 0x0}, - 788: {region: 0x37, script: 0x5b, flags: 0x0}, - 789: {region: 0x166, script: 0x5b, flags: 0x0}, - 790: {region: 0x166, script: 0x5b, flags: 0x0}, - 791: {region: 0x166, script: 0x5b, flags: 0x0}, - 792: {region: 0x166, script: 0x5b, flags: 0x0}, - 793: {region: 0x166, script: 0x5b, flags: 0x0}, - 794: {region: 0x166, script: 0x5b, flags: 0x0}, - 795: {region: 0x9a, script: 0x22, flags: 0x0}, - 796: {region: 0xdc, script: 0x22, flags: 0x0}, - 797: {region: 0x107, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x73, flags: 0x0}, - 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcc, script: 0x5b, flags: 0x0}, - 801: {region: 0x166, script: 0x5b, flags: 0x0}, - 802: {region: 0x166, script: 0x5b, flags: 0x0}, - 803: {region: 0x166, script: 0x5b, flags: 0x0}, - 804: {region: 0x9a, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5b, flags: 0x0}, - 807: {region: 0x166, script: 0x5b, flags: 0x0}, - 808: {region: 0x136, script: 0x5b, flags: 0x0}, - 809: {region: 0x166, script: 0x5b, flags: 0x0}, - 810: {region: 0x166, script: 0x5b, flags: 0x0}, - 811: {region: 0xe9, script: 0x5, flags: 0x0}, - 812: {region: 0xc4, script: 0x5b, flags: 0x0}, - 813: {region: 0x9a, script: 0x22, flags: 0x0}, - 814: {region: 0x96, script: 0x5b, flags: 0x0}, - 815: {region: 0x165, script: 0x5b, flags: 0x0}, - 816: {region: 0x166, script: 0x5b, flags: 0x0}, - 817: {region: 0xc5, script: 0x76, flags: 0x0}, - 818: {region: 0x166, script: 0x5b, flags: 0x0}, - 819: {region: 0x166, script: 0x2c, flags: 0x0}, - 820: {region: 0x107, script: 0x20, flags: 0x0}, - 821: {region: 0x166, script: 0x5b, flags: 0x0}, - 822: {region: 0x132, script: 0x5b, flags: 0x0}, - 823: {region: 0x9d, script: 0x67, flags: 0x0}, - 824: {region: 0x166, script: 0x5b, flags: 0x0}, - 825: {region: 0x166, script: 0x5b, flags: 0x0}, - 826: {region: 0x9d, script: 0x5, flags: 0x0}, - 827: {region: 0x166, script: 0x5b, flags: 0x0}, - 828: {region: 0x166, script: 0x5b, flags: 0x0}, - 829: {region: 0x166, script: 0x5b, flags: 0x0}, - 830: {region: 0xde, script: 0x5b, flags: 0x0}, - 831: {region: 0x166, script: 0x5b, flags: 0x0}, - 832: {region: 0x166, script: 0x5b, flags: 0x0}, - 834: {region: 0x166, script: 0x5b, flags: 0x0}, - 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9f, script: 0x5b, flags: 0x0}, - 837: {region: 0xd3, script: 0x5b, flags: 0x0}, - 838: {region: 0x166, script: 0x5b, flags: 0x0}, - 839: {region: 0xdb, script: 0x5b, flags: 0x0}, - 840: {region: 0x166, script: 0x5b, flags: 0x0}, - 841: {region: 0x166, script: 0x5b, flags: 0x0}, - 842: {region: 0x166, script: 0x5b, flags: 0x0}, - 843: {region: 0xd0, script: 0x5b, flags: 0x0}, - 844: {region: 0x166, script: 0x5b, flags: 0x0}, - 845: {region: 0x166, script: 0x5b, flags: 0x0}, - 846: {region: 0x165, script: 0x5b, flags: 0x0}, - 847: {region: 0xd2, script: 0x5b, flags: 0x0}, - 848: {region: 0x61, script: 0x5b, flags: 0x0}, - 849: {region: 0xdc, script: 0x22, flags: 0x0}, - 850: {region: 0x166, script: 0x5b, flags: 0x0}, - 851: {region: 0xdc, script: 0x22, flags: 0x0}, - 852: {region: 0x166, script: 0x5b, flags: 0x0}, - 853: {region: 0x166, script: 0x5b, flags: 0x0}, - 854: {region: 0xd3, script: 0x5b, flags: 0x0}, - 855: {region: 0x166, script: 0x5b, flags: 0x0}, - 856: {region: 0x166, script: 0x5b, flags: 0x0}, - 857: {region: 0xd2, script: 0x5b, flags: 0x0}, - 858: {region: 0x166, script: 0x5b, flags: 0x0}, - 859: {region: 0xd0, script: 0x5b, flags: 0x0}, - 860: {region: 0xd0, script: 0x5b, flags: 0x0}, - 861: {region: 0x166, script: 0x5b, flags: 0x0}, - 862: {region: 0x166, script: 0x5b, flags: 0x0}, - 863: {region: 0x96, script: 0x5b, flags: 0x0}, - 864: {region: 0x166, script: 0x5b, flags: 0x0}, - 865: {region: 0xe0, script: 0x5b, flags: 0x0}, - 866: {region: 0x166, script: 0x5b, flags: 0x0}, - 867: {region: 0x166, script: 0x5b, flags: 0x0}, - 868: {region: 0x9a, script: 0x5b, flags: 0x0}, - 869: {region: 0x166, script: 0x5b, flags: 0x0}, - 870: {region: 0x166, script: 0x5b, flags: 0x0}, - 871: {region: 0xda, script: 0x5b, flags: 0x0}, - 872: {region: 0x52, script: 0x5b, flags: 0x0}, - 873: {region: 0x166, script: 0x5b, flags: 0x0}, - 874: {region: 0xdb, script: 0x5b, flags: 0x0}, - 875: {region: 0x166, script: 0x5b, flags: 0x0}, - 876: {region: 0x52, script: 0x5b, flags: 0x0}, - 877: {region: 0x166, script: 0x5b, flags: 0x0}, - 878: {region: 0x166, script: 0x5b, flags: 0x0}, - 879: {region: 0xdb, script: 0x5b, flags: 0x0}, - 880: {region: 0x124, script: 0x57, flags: 0x0}, - 881: {region: 0x9a, script: 0x22, flags: 0x0}, - 882: {region: 0x10d, script: 0xcb, flags: 0x0}, - 883: {region: 0x166, script: 0x5b, flags: 0x0}, - 884: {region: 0x166, script: 0x5b, flags: 0x0}, - 885: {region: 0x85, script: 0x7e, flags: 0x0}, - 886: {region: 0x162, script: 0x5b, flags: 0x0}, - 887: {region: 0x166, script: 0x5b, flags: 0x0}, - 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x166, script: 0x5b, flags: 0x0}, - 890: {region: 0x162, script: 0x5b, flags: 0x0}, - 891: {region: 0x166, script: 0x5b, flags: 0x0}, - 892: {region: 0x166, script: 0x5b, flags: 0x0}, - 893: {region: 0x166, script: 0x5b, flags: 0x0}, - 894: {region: 0x166, script: 0x5b, flags: 0x0}, - 895: {region: 0x166, script: 0x5b, flags: 0x0}, - 896: {region: 0x118, script: 0x5b, flags: 0x0}, - 897: {region: 0x166, script: 0x5b, flags: 0x0}, - 898: {region: 0x166, script: 0x5b, flags: 0x0}, - 899: {region: 0x136, script: 0x5b, flags: 0x0}, - 900: {region: 0x166, script: 0x5b, flags: 0x0}, - 901: {region: 0x53, script: 0x5b, flags: 0x0}, - 902: {region: 0x166, script: 0x5b, flags: 0x0}, - 903: {region: 0xcf, script: 0x5b, flags: 0x0}, - 904: {region: 0x130, script: 0x5b, flags: 0x0}, - 905: {region: 0x132, script: 0x5b, flags: 0x0}, - 906: {region: 0x81, script: 0x5b, flags: 0x0}, - 907: {region: 0x79, script: 0x5b, flags: 0x0}, - 908: {region: 0x166, script: 0x5b, flags: 0x0}, - 910: {region: 0x166, script: 0x5b, flags: 0x0}, - 911: {region: 0x166, script: 0x5b, flags: 0x0}, - 912: {region: 0x70, script: 0x5b, flags: 0x0}, - 913: {region: 0x166, script: 0x5b, flags: 0x0}, - 914: {region: 0x166, script: 0x5b, flags: 0x0}, - 915: {region: 0x166, script: 0x5b, flags: 0x0}, - 916: {region: 0x166, script: 0x5b, flags: 0x0}, - 917: {region: 0x9a, script: 0x83, flags: 0x0}, - 918: {region: 0x166, script: 0x5b, flags: 0x0}, - 919: {region: 0x166, script: 0x5, flags: 0x0}, - 920: {region: 0x7e, script: 0x20, flags: 0x0}, - 921: {region: 0x136, script: 0x84, flags: 0x0}, - 922: {region: 0x166, script: 0x5, flags: 0x0}, - 923: {region: 0xc6, script: 0x82, flags: 0x0}, - 924: {region: 0x166, script: 0x5b, flags: 0x0}, - 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe8, script: 0x5b, flags: 0x0}, - 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe8, script: 0x5b, flags: 0x0}, - 929: {region: 0x30, script: 0x5b, flags: 0x0}, - 930: {region: 0xf1, script: 0x5b, flags: 0x0}, - 931: {region: 0x166, script: 0x5b, flags: 0x0}, - 932: {region: 0x79, script: 0x5b, flags: 0x0}, - 933: {region: 0xd7, script: 0x5b, flags: 0x0}, - 934: {region: 0x136, script: 0x5b, flags: 0x0}, - 935: {region: 0x49, script: 0x5b, flags: 0x0}, - 936: {region: 0x166, script: 0x5b, flags: 0x0}, - 937: {region: 0x9d, script: 0xfa, flags: 0x0}, - 938: {region: 0x166, script: 0x5b, flags: 0x0}, - 939: {region: 0x61, script: 0x5b, flags: 0x0}, - 940: {region: 0x166, script: 0x5, flags: 0x0}, - 941: {region: 0xb1, script: 0x90, flags: 0x0}, - 943: {region: 0x166, script: 0x5b, flags: 0x0}, - 944: {region: 0x166, script: 0x5b, flags: 0x0}, - 945: {region: 0x9a, script: 0x12, flags: 0x0}, - 946: {region: 0xa5, script: 0x5b, flags: 0x0}, - 947: {region: 0xea, script: 0x5b, flags: 0x0}, - 948: {region: 0x166, script: 0x5b, flags: 0x0}, - 949: {region: 0x9f, script: 0x5b, flags: 0x0}, - 950: {region: 0x166, script: 0x5b, flags: 0x0}, - 951: {region: 0x166, script: 0x5b, flags: 0x0}, - 952: {region: 0x88, script: 0x34, flags: 0x0}, - 953: {region: 0x76, script: 0x5b, flags: 0x0}, - 954: {region: 0x166, script: 0x5b, flags: 0x0}, - 955: {region: 0xe9, script: 0x4e, flags: 0x0}, - 956: {region: 0x9d, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5b, flags: 0x0}, - 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x166, script: 0x5b, flags: 0x0}, - 960: {region: 0x41, script: 0x5b, flags: 0x0}, - 961: {region: 0x166, script: 0x5b, flags: 0x0}, - 962: {region: 0x7b, script: 0x5b, flags: 0x0}, - 963: {region: 0x166, script: 0x5b, flags: 0x0}, - 964: {region: 0xe5, script: 0x5b, flags: 0x0}, - 965: {region: 0x8a, script: 0x5b, flags: 0x0}, - 966: {region: 0x6a, script: 0x5b, flags: 0x0}, - 967: {region: 0x166, script: 0x5b, flags: 0x0}, - 968: {region: 0x9a, script: 0x22, flags: 0x0}, - 969: {region: 0x166, script: 0x5b, flags: 0x0}, - 970: {region: 0x103, script: 0x5b, flags: 0x0}, - 971: {region: 0x96, script: 0x5b, flags: 0x0}, - 972: {region: 0x166, script: 0x5b, flags: 0x0}, - 973: {region: 0x166, script: 0x5b, flags: 0x0}, - 974: {region: 0x9f, script: 0x5b, flags: 0x0}, - 975: {region: 0x166, script: 0x5, flags: 0x0}, - 976: {region: 0x9a, script: 0x5b, flags: 0x0}, - 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdc, script: 0x22, flags: 0x0}, - 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5b, flags: 0x0}, - 981: {region: 0x73, script: 0x5b, flags: 0x0}, - 982: {region: 0x4e, script: 0x5b, flags: 0x0}, - 983: {region: 0x9d, script: 0x5, flags: 0x0}, - 984: {region: 0x10d, script: 0x5b, flags: 0x0}, - 985: {region: 0x3a, script: 0x5b, flags: 0x0}, - 986: {region: 0x166, script: 0x5b, flags: 0x0}, - 987: {region: 0xd2, script: 0x5b, flags: 0x0}, - 988: {region: 0x105, script: 0x5b, flags: 0x0}, - 989: {region: 0x96, script: 0x5b, flags: 0x0}, - 990: {region: 0x130, script: 0x5b, flags: 0x0}, - 991: {region: 0x166, script: 0x5b, flags: 0x0}, - 992: {region: 0x166, script: 0x5b, flags: 0x0}, - 993: {region: 0x74, script: 0x5b, flags: 0x0}, - 994: {region: 0x107, script: 0x20, flags: 0x0}, - 995: {region: 0x131, script: 0x20, flags: 0x0}, - 996: {region: 0x10a, script: 0x5b, flags: 0x0}, - 997: {region: 0x108, script: 0x5b, flags: 0x0}, - 998: {region: 0x130, script: 0x5b, flags: 0x0}, - 999: {region: 0x166, script: 0x5b, flags: 0x0}, - 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, - 1001: {region: 0x9a, script: 0x22, flags: 0x0}, - 1002: {region: 0x81, script: 0x5b, flags: 0x0}, - 1003: {region: 0x107, script: 0x20, flags: 0x0}, - 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, - 1005: {region: 0x96, script: 0x5b, flags: 0x0}, - 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, - 1007: {region: 0x115, script: 0x5b, flags: 0x0}, - 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, - 1009: {region: 0x166, script: 0x5b, flags: 0x0}, - 1010: {region: 0x166, script: 0x5b, flags: 0x0}, - 1011: {region: 0x130, script: 0x5b, flags: 0x0}, - 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, - 1013: {region: 0x9a, script: 0x22, flags: 0x0}, - 1014: {region: 0x166, script: 0x5, flags: 0x0}, - 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, - 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, - 1017: {region: 0x49, script: 0x5b, flags: 0x0}, - 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, - 1020: {region: 0x9d, script: 0x5, flags: 0x0}, - 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, - 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, - 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, - 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, - 1027: {region: 0x97, script: 0x80, flags: 0x0}, - 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, - 1029: {region: 0x166, script: 0x2c, flags: 0x0}, - 1030: {region: 0x166, script: 0x5b, flags: 0x0}, - 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, - 1033: {region: 0x166, script: 0x5b, flags: 0x0}, - 1034: {region: 0xc5, script: 0x76, flags: 0x0}, - 1035: {region: 0x166, script: 0x5, flags: 0x0}, - 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, - 1037: {region: 0x70, script: 0x5b, flags: 0x0}, - 1038: {region: 0x166, script: 0x5b, flags: 0x0}, - 1039: {region: 0x166, script: 0x5b, flags: 0x0}, - 1040: {region: 0x166, script: 0x5b, flags: 0x0}, - 1041: {region: 0x166, script: 0x5b, flags: 0x0}, - 1042: {region: 0x112, script: 0x5b, flags: 0x0}, - 1043: {region: 0x166, script: 0x5b, flags: 0x0}, - 1044: {region: 0xe9, script: 0x5, flags: 0x0}, - 1045: {region: 0x166, script: 0x5b, flags: 0x0}, - 1046: {region: 0x110, script: 0x5b, flags: 0x0}, - 1047: {region: 0x166, script: 0x5b, flags: 0x0}, - 1048: {region: 0xea, script: 0x5b, flags: 0x0}, - 1049: {region: 0x166, script: 0x5b, flags: 0x0}, - 1050: {region: 0x96, script: 0x5b, flags: 0x0}, - 1051: {region: 0x143, script: 0x5b, flags: 0x0}, - 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, - 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, - 1055: {region: 0x73, script: 0x5b, flags: 0x0}, - 1056: {region: 0x98, script: 0xcc, flags: 0x0}, - 1057: {region: 0x166, script: 0x5b, flags: 0x0}, - 1058: {region: 0x73, script: 0x5b, flags: 0x0}, - 1059: {region: 0x165, script: 0x5b, flags: 0x0}, - 1060: {region: 0x166, script: 0x5b, flags: 0x0}, - 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, - 1062: {region: 0x166, script: 0x5b, flags: 0x0}, - 1063: {region: 0x166, script: 0x5b, flags: 0x0}, - 1064: {region: 0x166, script: 0x5b, flags: 0x0}, - 1065: {region: 0x116, script: 0x5b, flags: 0x0}, - 1066: {region: 0x166, script: 0x5b, flags: 0x0}, - 1067: {region: 0x166, script: 0x5b, flags: 0x0}, - 1068: {region: 0x124, script: 0xee, flags: 0x0}, - 1069: {region: 0x166, script: 0x5b, flags: 0x0}, - 1070: {region: 0x166, script: 0x5b, flags: 0x0}, - 1071: {region: 0x166, script: 0x5b, flags: 0x0}, - 1072: {region: 0x166, script: 0x5b, flags: 0x0}, - 1073: {region: 0x27, script: 0x5b, flags: 0x0}, - 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, - 1076: {region: 0x117, script: 0x5b, flags: 0x0}, - 1077: {region: 0x115, script: 0x5b, flags: 0x0}, - 1078: {region: 0x9a, script: 0x22, flags: 0x0}, - 1079: {region: 0x162, script: 0x5b, flags: 0x0}, - 1080: {region: 0x166, script: 0x5b, flags: 0x0}, - 1081: {region: 0x166, script: 0x5b, flags: 0x0}, - 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, - 1083: {region: 0x162, script: 0x5b, flags: 0x0}, - 1084: {region: 0x166, script: 0x5b, flags: 0x0}, - 1085: {region: 0x61, script: 0x5b, flags: 0x0}, - 1086: {region: 0x96, script: 0x5b, flags: 0x0}, - 1087: {region: 0x166, script: 0x5b, flags: 0x0}, - 1088: {region: 0x166, script: 0x5b, flags: 0x0}, - 1089: {region: 0x130, script: 0x5b, flags: 0x0}, - 1090: {region: 0x166, script: 0x5b, flags: 0x0}, - 1091: {region: 0x85, script: 0x5b, flags: 0x0}, - 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, - 1093: {region: 0x130, script: 0x5b, flags: 0x0}, - 1094: {region: 0x160, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, - 1096: {region: 0x61, script: 0x5b, flags: 0x0}, - 1097: {region: 0x166, script: 0x5b, flags: 0x0}, - 1098: {region: 0x9a, script: 0x22, flags: 0x0}, - 1099: {region: 0x96, script: 0x5b, flags: 0x0}, - 1100: {region: 0x166, script: 0x5b, flags: 0x0}, - 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9c, script: 0xde, flags: 0x0}, - 1103: {region: 0xea, script: 0x5b, flags: 0x0}, - 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, - 1105: {region: 0xdc, script: 0x22, flags: 0x0}, - 1106: {region: 0x166, script: 0x5b, flags: 0x0}, - 1107: {region: 0x166, script: 0x5b, flags: 0x0}, - 1108: {region: 0x166, script: 0x5b, flags: 0x0}, - 1109: {region: 0x166, script: 0x5b, flags: 0x0}, - 1110: {region: 0x166, script: 0x5b, flags: 0x0}, - 1111: {region: 0x166, script: 0x5b, flags: 0x0}, - 1112: {region: 0x166, script: 0x5b, flags: 0x0}, - 1113: {region: 0x166, script: 0x5b, flags: 0x0}, - 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, - 1115: {region: 0x166, script: 0x5b, flags: 0x0}, - 1116: {region: 0x166, script: 0x5b, flags: 0x0}, - 1117: {region: 0x9a, script: 0x53, flags: 0x0}, - 1118: {region: 0x53, script: 0xe4, flags: 0x0}, - 1119: {region: 0xdc, script: 0x22, flags: 0x0}, - 1120: {region: 0xdc, script: 0x22, flags: 0x0}, - 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, - 1122: {region: 0x166, script: 0x5b, flags: 0x0}, - 1123: {region: 0x113, script: 0x5b, flags: 0x0}, - 1124: {region: 0x132, script: 0x5b, flags: 0x0}, - 1125: {region: 0x127, script: 0x5b, flags: 0x0}, - 1126: {region: 0x166, script: 0x5b, flags: 0x0}, - 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x166, script: 0x5b, flags: 0x0}, - 1129: {region: 0x166, script: 0x5b, flags: 0x0}, - 1130: {region: 0x166, script: 0x5b, flags: 0x0}, - 1131: {region: 0x124, script: 0xee, flags: 0x0}, - 1132: {region: 0xdc, script: 0x22, flags: 0x0}, - 1133: {region: 0xdc, script: 0x22, flags: 0x0}, - 1134: {region: 0xdc, script: 0x22, flags: 0x0}, - 1135: {region: 0x70, script: 0x2c, flags: 0x0}, - 1136: {region: 0x166, script: 0x5b, flags: 0x0}, - 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, - 1138: {region: 0x166, script: 0x5b, flags: 0x0}, - 1139: {region: 0x166, script: 0x5b, flags: 0x0}, - 1140: {region: 0x166, script: 0x5b, flags: 0x0}, - 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, - 1142: {region: 0x128, script: 0x5b, flags: 0x0}, - 1143: {region: 0x126, script: 0x5b, flags: 0x0}, - 1144: {region: 0x32, script: 0x5b, flags: 0x0}, - 1145: {region: 0xdc, script: 0x22, flags: 0x0}, - 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, - 1147: {region: 0x166, script: 0x5b, flags: 0x0}, - 1148: {region: 0x166, script: 0x5b, flags: 0x0}, - 1149: {region: 0x32, script: 0x5b, flags: 0x0}, - 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, - 1151: {region: 0x166, script: 0x5b, flags: 0x0}, - 1152: {region: 0x162, script: 0x5b, flags: 0x0}, - 1153: {region: 0x166, script: 0x5b, flags: 0x0}, - 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, - 1155: {region: 0x166, script: 0x5b, flags: 0x0}, - 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, - 1157: {region: 0x166, script: 0x5b, flags: 0x0}, - 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, - 1159: {region: 0x166, script: 0x5b, flags: 0x0}, - 1160: {region: 0x166, script: 0x5b, flags: 0x0}, - 1161: {region: 0x166, script: 0x5b, flags: 0x0}, - 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, - 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, - 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, - 1165: {region: 0x166, script: 0x5, flags: 0x0}, - 1166: {region: 0x162, script: 0x5b, flags: 0x0}, - 1167: {region: 0x88, script: 0x34, flags: 0x0}, - 1168: {region: 0xdc, script: 0x22, flags: 0x0}, - 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, - 1170: {region: 0x43, script: 0xef, flags: 0x0}, - 1171: {region: 0x166, script: 0x5b, flags: 0x0}, - 1172: {region: 0x107, script: 0x20, flags: 0x0}, - 1173: {region: 0x166, script: 0x5b, flags: 0x0}, - 1174: {region: 0x166, script: 0x5b, flags: 0x0}, - 1175: {region: 0x132, script: 0x5b, flags: 0x0}, - 1176: {region: 0x166, script: 0x5b, flags: 0x0}, - 1177: {region: 0x124, script: 0xee, flags: 0x0}, - 1178: {region: 0x32, script: 0x5b, flags: 0x0}, - 1179: {region: 0x166, script: 0x5b, flags: 0x0}, - 1180: {region: 0x166, script: 0x5b, flags: 0x0}, - 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, - 1182: {region: 0x166, script: 0x5b, flags: 0x0}, - 1183: {region: 0x166, script: 0x5b, flags: 0x0}, - 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, - 1185: {region: 0x166, script: 0x5b, flags: 0x0}, - 1187: {region: 0x166, script: 0x5b, flags: 0x0}, - 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, - 1189: {region: 0x53, script: 0xe7, flags: 0x0}, - 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, - 1191: {region: 0x166, script: 0x5b, flags: 0x0}, - 1192: {region: 0x107, script: 0x20, flags: 0x0}, - 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, - 1194: {region: 0x166, script: 0x5b, flags: 0x0}, - 1195: {region: 0x107, script: 0x20, flags: 0x0}, - 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, - 1198: {region: 0x131, script: 0x20, flags: 0x0}, - 1199: {region: 0x76, script: 0x5b, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, - 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x9a, script: 0xe, flags: 0x0}, - 1204: {region: 0xe9, script: 0x5, flags: 0x0}, - 1205: {region: 0x166, script: 0x5b, flags: 0x0}, - 1206: {region: 0x166, script: 0x5b, flags: 0x0}, - 1207: {region: 0x166, script: 0x5b, flags: 0x0}, - 1208: {region: 0x166, script: 0x5b, flags: 0x0}, - 1209: {region: 0x166, script: 0x5b, flags: 0x0}, - 1210: {region: 0x166, script: 0x5b, flags: 0x0}, - 1211: {region: 0x166, script: 0x5b, flags: 0x0}, - 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x166, script: 0x5b, flags: 0x0}, - 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, - 1215: {region: 0x166, script: 0x5b, flags: 0x0}, - 1216: {region: 0x162, script: 0x5b, flags: 0x0}, - 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, - 1218: {region: 0x107, script: 0x5b, flags: 0x0}, - 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, - 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, - 1221: {region: 0x166, script: 0x5b, flags: 0x0}, - 1222: {region: 0x36, script: 0x5b, flags: 0x0}, - 1223: {region: 0x61, script: 0x5b, flags: 0x0}, - 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, - 1225: {region: 0x1, script: 0x5b, flags: 0x0}, - 1226: {region: 0x107, script: 0x5b, flags: 0x0}, - 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, - 1228: {region: 0x130, script: 0x5b, flags: 0x0}, - 1229: {region: 0x166, script: 0x5b, flags: 0x0}, - 1230: {region: 0x36, script: 0x5b, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, - 1232: {region: 0x166, script: 0x5b, flags: 0x0}, - 1233: {region: 0x70, script: 0x2c, flags: 0x0}, - 1234: {region: 0x166, script: 0x5b, flags: 0x0}, - 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, - 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, - 1238: {region: 0x9a, script: 0x22, flags: 0x0}, - 1239: {region: 0x166, script: 0x5b, flags: 0x0}, - 1240: {region: 0x166, script: 0x5b, flags: 0x0}, - 1241: {region: 0x166, script: 0x5b, flags: 0x0}, - 1242: {region: 0x166, script: 0x5b, flags: 0x0}, - 1243: {region: 0x166, script: 0x5b, flags: 0x0}, - 1244: {region: 0x166, script: 0x5b, flags: 0x0}, - 1245: {region: 0x166, script: 0x5b, flags: 0x0}, - 1246: {region: 0x166, script: 0x5b, flags: 0x0}, - 1247: {region: 0x166, script: 0x5b, flags: 0x0}, - 1248: {region: 0x141, script: 0x5b, flags: 0x0}, - 1249: {region: 0x166, script: 0x5b, flags: 0x0}, - 1250: {region: 0x166, script: 0x5b, flags: 0x0}, - 1251: {region: 0xa9, script: 0x5, flags: 0x0}, - 1252: {region: 0x166, script: 0x5b, flags: 0x0}, - 1253: {region: 0x115, script: 0x5b, flags: 0x0}, - 1254: {region: 0x166, script: 0x5b, flags: 0x0}, - 1255: {region: 0x166, script: 0x5b, flags: 0x0}, - 1256: {region: 0x166, script: 0x5b, flags: 0x0}, - 1257: {region: 0x166, script: 0x5b, flags: 0x0}, - 1258: {region: 0x9a, script: 0x22, flags: 0x0}, - 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x166, script: 0x5b, flags: 0x0}, - 1261: {region: 0x166, script: 0x5b, flags: 0x0}, - 1262: {region: 0x41, script: 0x5b, flags: 0x0}, - 1263: {region: 0x166, script: 0x5b, flags: 0x0}, - 1264: {region: 0x12c, script: 0x18, flags: 0x0}, - 1265: {region: 0x166, script: 0x5b, flags: 0x0}, - 1266: {region: 0x162, script: 0x5b, flags: 0x0}, - 1267: {region: 0x166, script: 0x5b, flags: 0x0}, - 1268: {region: 0x12c, script: 0x63, flags: 0x0}, - 1269: {region: 0x12c, script: 0x64, flags: 0x0}, - 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x68, flags: 0x0}, - 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, - 1273: {region: 0x109, script: 0x79, flags: 0x0}, - 1274: {region: 0x9a, script: 0x22, flags: 0x0}, - 1275: {region: 0x132, script: 0x5b, flags: 0x0}, - 1276: {region: 0x166, script: 0x5b, flags: 0x0}, - 1277: {region: 0x9d, script: 0x93, flags: 0x0}, - 1278: {region: 0x166, script: 0x5b, flags: 0x0}, - 1279: {region: 0x15f, script: 0xce, flags: 0x0}, - 1280: {region: 0x166, script: 0x5b, flags: 0x0}, - 1281: {region: 0x166, script: 0x5b, flags: 0x0}, - 1282: {region: 0xdc, script: 0x22, flags: 0x0}, - 1283: {region: 0x166, script: 0x5b, flags: 0x0}, - 1284: {region: 0x166, script: 0x5b, flags: 0x0}, - 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, - 1286: {region: 0x76, script: 0x5b, flags: 0x0}, - 1287: {region: 0x166, script: 0x5b, flags: 0x0}, - 1288: {region: 0x166, script: 0x5b, flags: 0x0}, - 1289: {region: 0x52, script: 0x5b, flags: 0x0}, - 1290: {region: 0x166, script: 0x5b, flags: 0x0}, - 1291: {region: 0x166, script: 0x5b, flags: 0x0}, - 1292: {region: 0x166, script: 0x5b, flags: 0x0}, - 1293: {region: 0x52, script: 0x5b, flags: 0x0}, - 1294: {region: 0x166, script: 0x5b, flags: 0x0}, - 1295: {region: 0x166, script: 0x5b, flags: 0x0}, - 1296: {region: 0x166, script: 0x5b, flags: 0x0}, - 1297: {region: 0x166, script: 0x5b, flags: 0x0}, - 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x166, script: 0x5b, flags: 0x0}, - 1300: {region: 0x166, script: 0x5b, flags: 0x0}, - 1301: {region: 0x166, script: 0x5b, flags: 0x0}, - 1302: {region: 0x166, script: 0x5b, flags: 0x0}, - 1303: {region: 0x166, script: 0x5b, flags: 0x0}, - 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, - 1305: {region: 0x166, script: 0x5b, flags: 0x0}, - 1306: {region: 0x166, script: 0x5b, flags: 0x0}, - 1307: {region: 0x166, script: 0x5b, flags: 0x0}, - 1308: {region: 0x41, script: 0x5b, flags: 0x0}, - 1309: {region: 0x166, script: 0x5b, flags: 0x0}, - 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, - 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x166, script: 0x5b, flags: 0x0}, - 1313: {region: 0x166, script: 0x5b, flags: 0x0}, - 1314: {region: 0x166, script: 0x5b, flags: 0x0}, - 1315: {region: 0x53, script: 0x5b, flags: 0x0}, - 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, - 1318: {region: 0xa9, script: 0x5, flags: 0x0}, - 1319: {region: 0xda, script: 0x5b, flags: 0x0}, - 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, - 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7f, flags: 0x0}, - 1323: {region: 0x166, script: 0x5b, flags: 0x0}, - 1324: {region: 0x123, script: 0x5b, flags: 0x0}, - 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, - 1326: {region: 0x166, script: 0x5b, flags: 0x0}, - 1327: {region: 0x162, script: 0x5b, flags: 0x0}, - 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, -} - -// likelyLangList holds lists info associated with likelyLang. -// Size: 582 bytes, 97 elements -var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9d, script: 0x7, flags: 0x0}, - 1: {region: 0xa2, script: 0x7a, flags: 0x2}, - 2: {region: 0x11d, script: 0x87, flags: 0x2}, - 3: {region: 0x32, script: 0x5b, flags: 0x0}, - 4: {region: 0x9c, script: 0x5, flags: 0x4}, - 5: {region: 0x9d, script: 0x5, flags: 0x4}, - 6: {region: 0x107, script: 0x20, flags: 0x4}, - 7: {region: 0x9d, script: 0x5, flags: 0x2}, - 8: {region: 0x107, script: 0x20, flags: 0x0}, - 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x136, script: 0x5b, flags: 0x0}, - 11: {region: 0x7c, script: 0xd1, flags: 0x2}, - 12: {region: 0x115, script: 0x5b, flags: 0x0}, - 13: {region: 0x85, script: 0x1, flags: 0x2}, - 14: {region: 0x5e, script: 0x1f, flags: 0x0}, - 15: {region: 0x88, script: 0x60, flags: 0x2}, - 16: {region: 0xd7, script: 0x5b, flags: 0x0}, - 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10c, script: 0x5, flags: 0x4}, - 19: {region: 0xaf, script: 0x20, flags: 0x0}, - 20: {region: 0x24, script: 0x5, flags: 0x4}, - 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9d, script: 0x5, flags: 0x4}, - 23: {region: 0xc6, script: 0x5, flags: 0x4}, - 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12c, script: 0x5b, flags: 0x0}, - 26: {region: 0xb1, script: 0x5, flags: 0x4}, - 27: {region: 0x9c, script: 0x5, flags: 0x2}, - 28: {region: 0xa6, script: 0x20, flags: 0x0}, - 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12c, script: 0x5b, flags: 0x4}, - 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12c, script: 0x5b, flags: 0x2}, - 33: {region: 0xdc, script: 0x22, flags: 0x0}, - 34: {region: 0x9a, script: 0x5e, flags: 0x2}, - 35: {region: 0x84, script: 0x5b, flags: 0x0}, - 36: {region: 0x85, script: 0x7e, flags: 0x4}, - 37: {region: 0x85, script: 0x7e, flags: 0x2}, - 38: {region: 0xc6, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x71, flags: 0x4}, - 40: {region: 0x53, script: 0x71, flags: 0x2}, - 41: {region: 0xd1, script: 0x5b, flags: 0x0}, - 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x96, script: 0x5, flags: 0x4}, - 44: {region: 0x9a, script: 0x36, flags: 0x0}, - 45: {region: 0xe9, script: 0x5, flags: 0x4}, - 46: {region: 0xe9, script: 0x5, flags: 0x2}, - 47: {region: 0x9d, script: 0x8d, flags: 0x0}, - 48: {region: 0x53, script: 0x8e, flags: 0x2}, - 49: {region: 0xbb, script: 0xeb, flags: 0x0}, - 50: {region: 0xda, script: 0x5b, flags: 0x4}, - 51: {region: 0xe9, script: 0x5, flags: 0x0}, - 52: {region: 0x9a, script: 0x22, flags: 0x2}, - 53: {region: 0x9a, script: 0x50, flags: 0x2}, - 54: {region: 0x9a, script: 0xd5, flags: 0x2}, - 55: {region: 0x106, script: 0x20, flags: 0x0}, - 56: {region: 0xbe, script: 0x5b, flags: 0x4}, - 57: {region: 0x105, script: 0x5b, flags: 0x4}, - 58: {region: 0x107, script: 0x5b, flags: 0x4}, - 59: {region: 0x12c, script: 0x5b, flags: 0x4}, - 60: {region: 0x125, script: 0x20, flags: 0x0}, - 61: {region: 0xe9, script: 0x5, flags: 0x4}, - 62: {region: 0xe9, script: 0x5, flags: 0x2}, - 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xaf, script: 0x20, flags: 0x4}, - 65: {region: 0xc6, script: 0x20, flags: 0x4}, - 66: {region: 0xaf, script: 0x20, flags: 0x2}, - 67: {region: 0x9a, script: 0xe, flags: 0x0}, - 68: {region: 0xdc, script: 0x22, flags: 0x4}, - 69: {region: 0xdc, script: 0x22, flags: 0x2}, - 70: {region: 0x138, script: 0x5b, flags: 0x0}, - 71: {region: 0x24, script: 0x5, flags: 0x4}, - 72: {region: 0x53, script: 0x20, flags: 0x4}, - 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8e, script: 0x3c, flags: 0x0}, - 75: {region: 0x53, script: 0x3b, flags: 0x4}, - 76: {region: 0x53, script: 0x3b, flags: 0x2}, - 77: {region: 0x53, script: 0x3b, flags: 0x0}, - 78: {region: 0x2f, script: 0x3c, flags: 0x4}, - 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7c, script: 0x3c, flags: 0x4}, - 81: {region: 0x7f, script: 0x3c, flags: 0x4}, - 82: {region: 0x8e, script: 0x3c, flags: 0x4}, - 83: {region: 0x96, script: 0x3c, flags: 0x4}, - 84: {region: 0xc7, script: 0x3c, flags: 0x4}, - 85: {region: 0xd1, script: 0x3c, flags: 0x4}, - 86: {region: 0xe3, script: 0x3c, flags: 0x4}, - 87: {region: 0xe6, script: 0x3c, flags: 0x4}, - 88: {region: 0xe8, script: 0x3c, flags: 0x4}, - 89: {region: 0x117, script: 0x3c, flags: 0x4}, - 90: {region: 0x124, script: 0x3c, flags: 0x4}, - 91: {region: 0x12f, script: 0x3c, flags: 0x4}, - 92: {region: 0x136, script: 0x3c, flags: 0x4}, - 93: {region: 0x13f, script: 0x3c, flags: 0x4}, - 94: {region: 0x12f, script: 0x11, flags: 0x2}, - 95: {region: 0x12f, script: 0x37, flags: 0x2}, - 96: {region: 0x12f, script: 0x3c, flags: 0x2}, -} - -type likelyLangScript struct { - lang uint16 - script uint16 - flags uint8 -} - -// likelyRegion is a lookup table, indexed by regionID, for the most likely -// languages and scripts given incomplete information. If more entries exist -// for a given regionID, lang and script are the index and size respectively -// of the list in likelyRegionList. -// TODO: exclude containers and user-definable regions from the list. -// Size: 2154 bytes, 359 elements -var likelyRegion = [359]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, - 35: {lang: 0x3a, script: 0x5, flags: 0x0}, - 36: {lang: 0x0, script: 0x2, flags: 0x1}, - 39: {lang: 0x2, script: 0x2, flags: 0x1}, - 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 43: {lang: 0x0, script: 0x5b, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, - 48: {lang: 0x367, script: 0x5b, flags: 0x0}, - 49: {lang: 0x444, script: 0x5b, flags: 0x0}, - 50: {lang: 0x58, script: 0x5b, flags: 0x0}, - 51: {lang: 0x6, script: 0x2, flags: 0x1}, - 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5b, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 56: {lang: 0x7e, script: 0x20, flags: 0x0}, - 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5b, flags: 0x0}, - 71: {lang: 0x71, script: 0x20, flags: 0x0}, - 73: {lang: 0x512, script: 0x3e, flags: 0x2}, - 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5b, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 85: {lang: 0x0, script: 0x5b, flags: 0x0}, - 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, - 94: {lang: 0xe, script: 0x2, flags: 0x1}, - 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, - 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, - 99: {lang: 0x1, script: 0x5b, flags: 0x0}, - 100: {lang: 0x101, script: 0x5b, flags: 0x0}, - 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 104: {lang: 0x10, script: 0x2, flags: 0x1}, - 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 107: {lang: 0x140, script: 0x5b, flags: 0x0}, - 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x3a, script: 0x5, flags: 0x0}, - 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 112: {lang: 0x12, script: 0x2, flags: 0x1}, - 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, - 115: {lang: 0x151, script: 0x5b, flags: 0x0}, - 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 119: {lang: 0x158, script: 0x5b, flags: 0x0}, - 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 124: {lang: 0x14, script: 0x2, flags: 0x1}, - 126: {lang: 0x16, script: 0x3, flags: 0x1}, - 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 129: {lang: 0x21, script: 0x5b, flags: 0x0}, - 131: {lang: 0x245, script: 0x5b, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 136: {lang: 0x19, script: 0x2, flags: 0x1}, - 137: {lang: 0x0, script: 0x5b, flags: 0x0}, - 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 142: {lang: 0x529, script: 0x3c, flags: 0x0}, - 143: {lang: 0x0, script: 0x5b, flags: 0x0}, - 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, - 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, - 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, - 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 150: {lang: 0x1b, script: 0x2, flags: 0x1}, - 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 154: {lang: 0x1d, script: 0x3, flags: 0x1}, - 156: {lang: 0x3a, script: 0x5, flags: 0x0}, - 157: {lang: 0x20, script: 0x2, flags: 0x1}, - 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, - 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, - 162: {lang: 0x3a, script: 0x5, flags: 0x0}, - 163: {lang: 0x200, script: 0x49, flags: 0x0}, - 165: {lang: 0x445, script: 0x5b, flags: 0x0}, - 166: {lang: 0x28a, script: 0x20, flags: 0x0}, - 167: {lang: 0x22, script: 0x3, flags: 0x1}, - 169: {lang: 0x25, script: 0x2, flags: 0x1}, - 171: {lang: 0x254, script: 0x54, flags: 0x0}, - 172: {lang: 0x254, script: 0x54, flags: 0x0}, - 173: {lang: 0x3a, script: 0x5, flags: 0x0}, - 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 176: {lang: 0x27, script: 0x2, flags: 0x1}, - 177: {lang: 0x3a, script: 0x5, flags: 0x0}, - 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, - 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, - 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, - 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, - 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, - 186: {lang: 0x3a, script: 0x5, flags: 0x0}, - 187: {lang: 0x29, script: 0x2, flags: 0x1}, - 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 189: {lang: 0x2b, script: 0x2, flags: 0x1}, - 190: {lang: 0x432, script: 0x5b, flags: 0x0}, - 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, - 195: {lang: 0x2d, script: 0x2, flags: 0x1}, - 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, - 197: {lang: 0x2f, script: 0x2, flags: 0x1}, - 198: {lang: 0x31, script: 0x2, flags: 0x1}, - 199: {lang: 0x33, script: 0x2, flags: 0x1}, - 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 202: {lang: 0x35, script: 0x2, flags: 0x1}, - 204: {lang: 0x320, script: 0x5b, flags: 0x0}, - 205: {lang: 0x37, script: 0x3, flags: 0x1}, - 206: {lang: 0x128, script: 0xed, flags: 0x0}, - 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, - 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 211: {lang: 0x16, script: 0x5b, flags: 0x0}, - 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, - 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 218: {lang: 0x367, script: 0x5b, flags: 0x0}, - 219: {lang: 0x347, script: 0x5b, flags: 0x0}, - 220: {lang: 0x351, script: 0x22, flags: 0x0}, - 226: {lang: 0x3a, script: 0x5, flags: 0x0}, - 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 231: {lang: 0x486, script: 0x5b, flags: 0x0}, - 232: {lang: 0x153, script: 0x5b, flags: 0x0}, - 233: {lang: 0x3a, script: 0x3, flags: 0x1}, - 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, - 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 238: {lang: 0x3a, script: 0x5, flags: 0x0}, - 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, - 242: {lang: 0x194, script: 0x5b, flags: 0x0}, - 244: {lang: 0x3a, script: 0x5, flags: 0x0}, - 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 261: {lang: 0x3d, script: 0x2, flags: 0x1}, - 262: {lang: 0x432, script: 0x20, flags: 0x0}, - 263: {lang: 0x3f, script: 0x2, flags: 0x1}, - 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, - 265: {lang: 0x3a, script: 0x5, flags: 0x0}, - 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 268: {lang: 0x3a, script: 0x5, flags: 0x0}, - 269: {lang: 0x41, script: 0x2, flags: 0x1}, - 272: {lang: 0x416, script: 0x5b, flags: 0x0}, - 273: {lang: 0x347, script: 0x5b, flags: 0x0}, - 274: {lang: 0x43, script: 0x2, flags: 0x1}, - 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, - 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 278: {lang: 0x429, script: 0x5b, flags: 0x0}, - 279: {lang: 0x367, script: 0x5b, flags: 0x0}, - 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 285: {lang: 0x45, script: 0x2, flags: 0x1}, - 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 291: {lang: 0x47, script: 0x2, flags: 0x1}, - 292: {lang: 0x49, script: 0x3, flags: 0x1}, - 293: {lang: 0x4c, script: 0x2, flags: 0x1}, - 294: {lang: 0x477, script: 0x5b, flags: 0x0}, - 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 296: {lang: 0x476, script: 0x5b, flags: 0x0}, - 297: {lang: 0x4e, script: 0x2, flags: 0x1}, - 298: {lang: 0x482, script: 0x5b, flags: 0x0}, - 300: {lang: 0x50, script: 0x4, flags: 0x1}, - 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, - 303: {lang: 0x54, script: 0x2, flags: 0x1}, - 304: {lang: 0x445, script: 0x5b, flags: 0x0}, - 305: {lang: 0x56, script: 0x3, flags: 0x1}, - 306: {lang: 0x445, script: 0x5b, flags: 0x0}, - 310: {lang: 0x512, script: 0x3e, flags: 0x2}, - 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, - 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, - 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, - 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, - 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, - 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, - 334: {lang: 0x59, script: 0x2, flags: 0x1}, - 351: {lang: 0x3a, script: 0x5, flags: 0x0}, - 352: {lang: 0x5b, script: 0x2, flags: 0x1}, - 357: {lang: 0x423, script: 0x5b, flags: 0x0}, -} - -// likelyRegionList holds lists info associated with likelyRegion. -// Size: 558 bytes, 93 elements -var likelyRegionList = [93]likelyLangScript{ - 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5b, flags: 0x0}, - 2: {lang: 0x431, script: 0x5b, flags: 0x0}, - 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5b, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, - 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xef, flags: 0x0}, - 9: {lang: 0x351, script: 0x22, flags: 0x0}, - 10: {lang: 0x529, script: 0x3b, flags: 0x0}, - 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5b, flags: 0x0}, - 13: {lang: 0x29a, script: 0xee, flags: 0x0}, - 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, - 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5b, flags: 0x0}, - 20: {lang: 0x26a, script: 0x5, flags: 0x2}, - 21: {lang: 0x512, script: 0x3e, flags: 0x2}, - 22: {lang: 0x210, script: 0x2e, flags: 0x0}, - 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5b, flags: 0x0}, - 25: {lang: 0x136, script: 0x34, flags: 0x0}, - 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, - 28: {lang: 0x31f, script: 0x5, flags: 0x0}, - 29: {lang: 0x1be, script: 0x22, flags: 0x0}, - 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x76, flags: 0x0}, - 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5b, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, - 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xee, flags: 0x0}, - 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, - 40: {lang: 0x226, script: 0xee, flags: 0x0}, - 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, - 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, - 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5b, flags: 0x0}, - 47: {lang: 0x331, script: 0x76, flags: 0x0}, - 48: {lang: 0x213, script: 0x5b, flags: 0x0}, - 49: {lang: 0x30b, script: 0x20, flags: 0x0}, - 50: {lang: 0x242, script: 0x5, flags: 0x0}, - 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, - 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, - 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 57: {lang: 0x88, script: 0x22, flags: 0x0}, - 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, - 62: {lang: 0x7e, script: 0x20, flags: 0x0}, - 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5b, flags: 0x0}, - 65: {lang: 0x444, script: 0x5b, flags: 0x0}, - 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5b, flags: 0x0}, - 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, - 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xee, flags: 0x0}, - 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x76, flags: 0x0}, - 76: {lang: 0x467, script: 0x20, flags: 0x0}, - 77: {lang: 0x148, script: 0x5, flags: 0x0}, - 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, - 81: {lang: 0x58, script: 0x5, flags: 0x0}, - 82: {lang: 0x219, script: 0x20, flags: 0x0}, - 83: {lang: 0x81, script: 0x34, flags: 0x0}, - 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, - 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, - 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, - 89: {lang: 0x431, script: 0x5b, flags: 0x0}, - 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, - 92: {lang: 0x446, script: 0x5, flags: 0x0}, -} - -type likelyTag struct { - lang uint16 - region uint16 - script uint16 -} - -// Size: 198 bytes, 33 elements -var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd7, script: 0x5b}, - 2: {lang: 0x139, region: 0x136, script: 0x5b}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, - 4: {lang: 0x139, region: 0x2f, script: 0x5b}, - 5: {lang: 0x139, region: 0xd7, script: 0x5b}, - 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, - 7: {lang: 0x445, region: 0x130, script: 0x5b}, - 8: {lang: 0x3a, region: 0x6c, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5b}, - 10: {lang: 0x139, region: 0x162, script: 0x5b}, - 11: {lang: 0x139, region: 0x136, script: 0x5b}, - 12: {lang: 0x139, region: 0x136, script: 0x5b}, - 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, - 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x9a, script: 0x22}, - 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, - 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, - 18: {lang: 0x139, region: 0x2f, script: 0x5b}, - 19: {lang: 0x139, region: 0xe7, script: 0x5b}, - 20: {lang: 0x139, region: 0x8b, script: 0x5b}, - 21: {lang: 0x41b, region: 0x143, script: 0x5b}, - 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, - 24: {lang: 0x3a, region: 0x109, script: 0x5}, - 25: {lang: 0x3e2, region: 0x107, script: 0x20}, - 26: {lang: 0x3e2, region: 0x107, script: 0x20}, - 27: {lang: 0x139, region: 0x7c, script: 0x5b}, - 28: {lang: 0x10d, region: 0x61, script: 0x5b}, - 29: {lang: 0x139, region: 0xd7, script: 0x5b}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, - 31: {lang: 0x139, region: 0x9b, script: 0x5b}, - 32: {lang: 0x139, region: 0x7c, script: 0x5b}, -} - -// Size: 264 bytes, 33 elements -var regionContainment = [33]uint64{ - // Entry 0 - 1F - 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, - 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, - 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, - 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, - 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, - 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, - 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, - // Entry 20 - 3F - 0x0000000100000000, -} - -// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -// where each set holds all groupings that are directly connected in a region -// containment graph. -// Size: 359 bytes, 359 elements -var regionInclusion = [359]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, - 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, - 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, - 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, - 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, - 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, - 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, - 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, - // Entry 40 - 7F - 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, - 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, - 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, - 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, - 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, - 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, - 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, - // Entry 80 - BF - 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, - 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, - 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, - 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, - 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, - 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, - 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, - 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, - // Entry C0 - FF - 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, - 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, - 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, - 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, - 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, - 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, - 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - // Entry 100 - 13F - 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, - 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, - 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, - 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, - 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, - 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, - 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, - 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, - // Entry 140 - 17F - 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, - 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, -} - -// regionInclusionBits is an array of bit vectors where every vector represents -// a set of region groupings. These sets are used to compute the distance -// between two regions for the purpose of language matching. -// Size: 584 bytes, 73 elements -var regionInclusionBits = [73]uint64{ - // Entry 0 - 1F - 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, - 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, - 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, - 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, - 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, - 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, - 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, - 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, - // Entry 20 - 3F - 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, - 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, - 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, - 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, - 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, - 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, - 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, - // Entry 40 - 5F - 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, - 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, - 0x0000000102020001, -} - -// regionInclusionNext marks, for each entry in regionInclusionBits, the set of -// all groups that are reachable from the groups set in the respective entry. -// Size: 73 bytes, 73 elements -var regionInclusionNext = [73]uint8{ - // Entry 0 - 3F - 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, - 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, - 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, - 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, - 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, - 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, - 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, - 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, - // Entry 40 - 7F - 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, - 0x43, -} - -type parentRel struct { - lang uint16 - script uint16 - maxScript uint16 - toRegion uint16 - fromRegion []uint16 -} - -// Size: 414 bytes, 5 elements -var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, -} - -// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go deleted file mode 100644 index e7afd31..0000000 --- a/vendor/golang.org/x/text/internal/language/tags.go +++ /dev/null @@ -1,48 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func MustParse(s string) Tag { - t, err := Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. -// It simplifies safe initialization of Base values. -func MustParseBase(s string) Language { - b, err := ParseBase(s) - if err != nil { - panic(err) - } - return b -} - -// MustParseScript is like ParseScript, but panics if the given script cannot be -// parsed. It simplifies safe initialization of Script values. -func MustParseScript(s string) Script { - scr, err := ParseScript(s) - if err != nil { - panic(err) - } - return scr -} - -// MustParseRegion is like ParseRegion, but panics if the given region cannot be -// parsed. It simplifies safe initialization of Region values. -func MustParseRegion(s string) Region { - r, err := ParseRegion(s) - if err != nil { - panic(err) - } - return r -} - -// Und is the root language. -var Und Tag diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go deleted file mode 100644 index 1cc004a..0000000 --- a/vendor/golang.org/x/text/internal/match.go +++ /dev/null @@ -1,67 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package internal - -// This file contains matchers that implement CLDR inheritance. -// -// See https://unicode.org/reports/tr35/#Locale_Inheritance. -// -// Some of the inheritance described in this document is already handled by -// the cldr package. - -import ( - "golang.org/x/text/language" -) - -// TODO: consider if (some of the) matching algorithm needs to be public after -// getting some feel about what is generic and what is specific. - -// NewInheritanceMatcher returns a matcher that matches based on the inheritance -// chain. -// -// The matcher uses canonicalization and the parent relationship to find a -// match. The resulting match will always be either Und or a language with the -// same language and script as the requested language. It will not match -// languages for which there is understood to be mutual or one-directional -// intelligibility. -// -// A Match will indicate an Exact match if the language matches after -// canonicalization and High if the matched tag is a parent. -func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { - tags := &InheritanceMatcher{make(map[language.Tag]int)} - for i, tag := range t { - ct, err := language.All.Canonicalize(tag) - if err != nil { - ct = tag - } - tags.index[ct] = i - } - return tags -} - -type InheritanceMatcher struct { - index map[language.Tag]int -} - -func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { - for _, t := range want { - ct, err := language.All.Canonicalize(t) - if err != nil { - ct = t - } - conf := language.Exact - for { - if index, ok := m.index[ct]; ok { - return ct, index, conf - } - if ct == language.Und { - break - } - ct = ct.Parent() - conf = language.High - } - } - return language.Und, 0, language.No -} diff --git a/vendor/golang.org/x/text/internal/number/common.go b/vendor/golang.org/x/text/internal/number/common.go deleted file mode 100644 index a6e9c8e..0000000 --- a/vendor/golang.org/x/text/internal/number/common.go +++ /dev/null @@ -1,55 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package number - -import ( - "unicode/utf8" - - "golang.org/x/text/internal/language/compact" -) - -// A system identifies a CLDR numbering system. -type system byte - -type systemData struct { - id system - digitSize byte // number of UTF-8 bytes per digit - zero [utf8.UTFMax]byte // UTF-8 sequence of zero digit. -} - -// A SymbolType identifies a symbol of a specific kind. -type SymbolType int - -const ( - SymDecimal SymbolType = iota - SymGroup - SymList - SymPercentSign - SymPlusSign - SymMinusSign - SymExponential - SymSuperscriptingExponent - SymPerMille - SymInfinity - SymNan - SymTimeSeparator - - NumSymbolTypes -) - -const hasNonLatnMask = 0x8000 - -// symOffset is an offset into altSymData if the bit indicated by hasNonLatnMask -// is not 0 (with this bit masked out), and an offset into symIndex otherwise. -// -// TODO: this type can be a byte again if we use an indirection into altsymData -// and introduce an alt -> offset slice (the length of this will be number of -// alternatives plus 1). This also allows getting rid of the compactTag field -// in altSymData. In total this will save about 1K. -type symOffset uint16 - -type altSymData struct { - compactTag compact.ID - symIndex symOffset - system system -} diff --git a/vendor/golang.org/x/text/internal/number/decimal.go b/vendor/golang.org/x/text/internal/number/decimal.go deleted file mode 100644 index e128cf3..0000000 --- a/vendor/golang.org/x/text/internal/number/decimal.go +++ /dev/null @@ -1,500 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate stringer -type RoundingMode - -package number - -import ( - "math" - "strconv" -) - -// RoundingMode determines how a number is rounded to the desired precision. -type RoundingMode byte - -const ( - ToNearestEven RoundingMode = iota // towards the nearest integer, or towards an even number if equidistant. - ToNearestZero // towards the nearest integer, or towards zero if equidistant. - ToNearestAway // towards the nearest integer, or away from zero if equidistant. - ToPositiveInf // towards infinity - ToNegativeInf // towards negative infinity - ToZero // towards zero - AwayFromZero // away from zero - numModes -) - -const maxIntDigits = 20 - -// A Decimal represents a floating point number in decimal format. -// Digits represents a number [0, 1.0), and the absolute value represented by -// Decimal is Digits * 10^Exp. Leading and trailing zeros may be omitted and Exp -// may point outside a valid position in Digits. -// -// Examples: -// -// Number Decimal -// 12345 Digits: [1, 2, 3, 4, 5], Exp: 5 -// 12.345 Digits: [1, 2, 3, 4, 5], Exp: 2 -// 12000 Digits: [1, 2], Exp: 5 -// 12000.00 Digits: [1, 2], Exp: 5 -// 0.00123 Digits: [1, 2, 3], Exp: -2 -// 0 Digits: [], Exp: 0 -type Decimal struct { - digits - - buf [maxIntDigits]byte -} - -type digits struct { - Digits []byte // mantissa digits, big-endian - Exp int32 // exponent - Neg bool - Inf bool // Takes precedence over Digits and Exp. - NaN bool // Takes precedence over Inf. -} - -// Digits represents a floating point number represented in digits of the -// base in which a number is to be displayed. It is similar to Decimal, but -// keeps track of trailing fraction zeros and the comma placement for -// engineering notation. Digits must have at least one digit. -// -// Examples: -// -// Number Decimal -// decimal -// 12345 Digits: [1, 2, 3, 4, 5], Exp: 5 End: 5 -// 12.345 Digits: [1, 2, 3, 4, 5], Exp: 2 End: 5 -// 12000 Digits: [1, 2], Exp: 5 End: 5 -// 12000.00 Digits: [1, 2], Exp: 5 End: 7 -// 0.00123 Digits: [1, 2, 3], Exp: -2 End: 3 -// 0 Digits: [], Exp: 0 End: 1 -// scientific (actual exp is Exp - Comma) -// 0e0 Digits: [0], Exp: 1, End: 1, Comma: 1 -// .0e0 Digits: [0], Exp: 0, End: 1, Comma: 0 -// 0.0e0 Digits: [0], Exp: 1, End: 2, Comma: 1 -// 1.23e4 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 1 -// .123e5 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 0 -// engineering -// 12.3e3 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 2 -type Digits struct { - digits - // End indicates the end position of the number. - End int32 // For decimals Exp <= End. For scientific len(Digits) <= End. - // Comma is used for the comma position for scientific (always 0 or 1) and - // engineering notation (always 0, 1, 2, or 3). - Comma uint8 - // IsScientific indicates whether this number is to be rendered as a - // scientific number. - IsScientific bool -} - -func (d *Digits) NumFracDigits() int { - if d.Exp >= d.End { - return 0 - } - return int(d.End - d.Exp) -} - -// normalize returns a new Decimal with leading and trailing zeros removed. -func (d *Decimal) normalize() (n Decimal) { - n = *d - b := n.Digits - // Strip leading zeros. Resulting number of digits is significant digits. - for len(b) > 0 && b[0] == 0 { - b = b[1:] - n.Exp-- - } - // Strip trailing zeros - for len(b) > 0 && b[len(b)-1] == 0 { - b = b[:len(b)-1] - } - if len(b) == 0 { - n.Exp = 0 - } - n.Digits = b - return n -} - -func (d *Decimal) clear() { - b := d.Digits - if b == nil { - b = d.buf[:0] - } - *d = Decimal{} - d.Digits = b[:0] -} - -func (x *Decimal) String() string { - if x.NaN { - return "NaN" - } - var buf []byte - if x.Neg { - buf = append(buf, '-') - } - if x.Inf { - buf = append(buf, "Inf"...) - return string(buf) - } - switch { - case len(x.Digits) == 0: - buf = append(buf, '0') - case x.Exp <= 0: - // 0.00ddd - buf = append(buf, "0."...) - buf = appendZeros(buf, -int(x.Exp)) - buf = appendDigits(buf, x.Digits) - - case /* 0 < */ int(x.Exp) < len(x.Digits): - // dd.ddd - buf = appendDigits(buf, x.Digits[:x.Exp]) - buf = append(buf, '.') - buf = appendDigits(buf, x.Digits[x.Exp:]) - - default: // len(x.Digits) <= x.Exp - // ddd00 - buf = appendDigits(buf, x.Digits) - buf = appendZeros(buf, int(x.Exp)-len(x.Digits)) - } - return string(buf) -} - -func appendDigits(buf []byte, digits []byte) []byte { - for _, c := range digits { - buf = append(buf, c+'0') - } - return buf -} - -// appendZeros appends n 0 digits to buf and returns buf. -func appendZeros(buf []byte, n int) []byte { - for ; n > 0; n-- { - buf = append(buf, '0') - } - return buf -} - -func (d *digits) round(mode RoundingMode, n int) { - if n >= len(d.Digits) { - return - } - // Make rounding decision: The result mantissa is truncated ("rounded down") - // by default. Decide if we need to increment, or "round up", the (unsigned) - // mantissa. - inc := false - switch mode { - case ToNegativeInf: - inc = d.Neg - case ToPositiveInf: - inc = !d.Neg - case ToZero: - // nothing to do - case AwayFromZero: - inc = true - case ToNearestEven: - inc = d.Digits[n] > 5 || d.Digits[n] == 5 && - (len(d.Digits) > n+1 || n == 0 || d.Digits[n-1]&1 != 0) - case ToNearestAway: - inc = d.Digits[n] >= 5 - case ToNearestZero: - inc = d.Digits[n] > 5 || d.Digits[n] == 5 && len(d.Digits) > n+1 - default: - panic("unreachable") - } - if inc { - d.roundUp(n) - } else { - d.roundDown(n) - } -} - -// roundFloat rounds a floating point number. -func (r RoundingMode) roundFloat(x float64) float64 { - // Make rounding decision: The result mantissa is truncated ("rounded down") - // by default. Decide if we need to increment, or "round up", the (unsigned) - // mantissa. - abs := x - if x < 0 { - abs = -x - } - i, f := math.Modf(abs) - if f == 0.0 { - return x - } - inc := false - switch r { - case ToNegativeInf: - inc = x < 0 - case ToPositiveInf: - inc = x >= 0 - case ToZero: - // nothing to do - case AwayFromZero: - inc = true - case ToNearestEven: - // TODO: check overflow - inc = f > 0.5 || f == 0.5 && int64(i)&1 != 0 - case ToNearestAway: - inc = f >= 0.5 - case ToNearestZero: - inc = f > 0.5 - default: - panic("unreachable") - } - if inc { - i += 1 - } - if abs != x { - i = -i - } - return i -} - -func (x *digits) roundUp(n int) { - if n < 0 || n >= len(x.Digits) { - return // nothing to do - } - // find first digit < 9 - for n > 0 && x.Digits[n-1] >= 9 { - n-- - } - - if n == 0 { - // all digits are 9s => round up to 1 and update exponent - x.Digits[0] = 1 // ok since len(x.Digits) > n - x.Digits = x.Digits[:1] - x.Exp++ - return - } - x.Digits[n-1]++ - x.Digits = x.Digits[:n] - // x already trimmed -} - -func (x *digits) roundDown(n int) { - if n < 0 || n >= len(x.Digits) { - return // nothing to do - } - x.Digits = x.Digits[:n] - trim(x) -} - -// trim cuts off any trailing zeros from x's mantissa; -// they are meaningless for the value of x. -func trim(x *digits) { - i := len(x.Digits) - for i > 0 && x.Digits[i-1] == 0 { - i-- - } - x.Digits = x.Digits[:i] - if i == 0 { - x.Exp = 0 - } -} - -// A Converter converts a number into decimals according to the given rounding -// criteria. -type Converter interface { - Convert(d *Decimal, r RoundingContext) -} - -const ( - signed = true - unsigned = false -) - -// Convert converts the given number to the decimal representation using the -// supplied RoundingContext. -func (d *Decimal) Convert(r RoundingContext, number interface{}) { - switch f := number.(type) { - case Converter: - d.clear() - f.Convert(d, r) - case float32: - d.ConvertFloat(r, float64(f), 32) - case float64: - d.ConvertFloat(r, f, 64) - case int: - d.ConvertInt(r, signed, uint64(f)) - case int8: - d.ConvertInt(r, signed, uint64(f)) - case int16: - d.ConvertInt(r, signed, uint64(f)) - case int32: - d.ConvertInt(r, signed, uint64(f)) - case int64: - d.ConvertInt(r, signed, uint64(f)) - case uint: - d.ConvertInt(r, unsigned, uint64(f)) - case uint8: - d.ConvertInt(r, unsigned, uint64(f)) - case uint16: - d.ConvertInt(r, unsigned, uint64(f)) - case uint32: - d.ConvertInt(r, unsigned, uint64(f)) - case uint64: - d.ConvertInt(r, unsigned, f) - - default: - d.NaN = true - // TODO: - // case string: if produced by strconv, allows for easy arbitrary pos. - // case reflect.Value: - // case big.Float - // case big.Int - // case big.Rat? - // catch underlyings using reflect or will this already be done by the - // message package? - } -} - -// ConvertInt converts an integer to decimals. -func (d *Decimal) ConvertInt(r RoundingContext, signed bool, x uint64) { - if r.Increment > 0 { - // TODO: if uint64 is too large, fall back to float64 - if signed { - d.ConvertFloat(r, float64(int64(x)), 64) - } else { - d.ConvertFloat(r, float64(x), 64) - } - return - } - d.clear() - if signed && int64(x) < 0 { - x = uint64(-int64(x)) - d.Neg = true - } - d.fillIntDigits(x) - d.Exp = int32(len(d.Digits)) -} - -// ConvertFloat converts a floating point number to decimals. -func (d *Decimal) ConvertFloat(r RoundingContext, x float64, size int) { - d.clear() - if math.IsNaN(x) { - d.NaN = true - return - } - // Simple case: decimal notation - if r.Increment > 0 { - scale := int(r.IncrementScale) - mult := 1.0 - if scale >= len(scales) { - mult = math.Pow(10, float64(scale)) - } else { - mult = scales[scale] - } - // We multiply x instead of dividing inc as it gives less rounding - // issues. - x *= mult - x /= float64(r.Increment) - x = r.Mode.roundFloat(x) - x *= float64(r.Increment) - x /= mult - } - - abs := x - if x < 0 { - d.Neg = true - abs = -x - } - if math.IsInf(abs, 1) { - d.Inf = true - return - } - - // By default we get the exact decimal representation. - verb := byte('g') - prec := -1 - // As the strconv API does not return the rounding accuracy, we can only - // round using ToNearestEven. - if r.Mode == ToNearestEven { - if n := r.RoundSignificantDigits(); n >= 0 { - prec = n - } else if n = r.RoundFractionDigits(); n >= 0 { - prec = n - verb = 'f' - } - } else { - // TODO: At this point strconv's rounding is imprecise to the point that - // it is not usable for this purpose. - // See https://github.com/golang/go/issues/21714 - // If rounding is requested, we ask for a large number of digits and - // round from there to simulate rounding only once. - // Ideally we would have strconv export an AppendDigits that would take - // a rounding mode and/or return an accuracy. Something like this would - // work: - // AppendDigits(dst []byte, x float64, base, size, prec int) (digits []byte, exp, accuracy int) - hasPrec := r.RoundSignificantDigits() >= 0 - hasScale := r.RoundFractionDigits() >= 0 - if hasPrec || hasScale { - // prec is the number of mantissa bits plus some extra for safety. - // We need at least the number of mantissa bits as decimals to - // accurately represent the floating point without rounding, as each - // bit requires one more decimal to represent: 0.5, 0.25, 0.125, ... - prec = 60 - } - } - - b := strconv.AppendFloat(d.Digits[:0], abs, verb, prec, size) - i := 0 - k := 0 - beforeDot := 1 - for i < len(b) { - if c := b[i]; '0' <= c && c <= '9' { - b[k] = c - '0' - k++ - d.Exp += int32(beforeDot) - } else if c == '.' { - beforeDot = 0 - d.Exp = int32(k) - } else { - break - } - i++ - } - d.Digits = b[:k] - if i != len(b) { - i += len("e") - pSign := i - exp := 0 - for i++; i < len(b); i++ { - exp *= 10 - exp += int(b[i] - '0') - } - if b[pSign] == '-' { - exp = -exp - } - d.Exp = int32(exp) + 1 - } -} - -func (d *Decimal) fillIntDigits(x uint64) { - if cap(d.Digits) < maxIntDigits { - d.Digits = d.buf[:] - } else { - d.Digits = d.buf[:maxIntDigits] - } - i := 0 - for ; x > 0; x /= 10 { - d.Digits[i] = byte(x % 10) - i++ - } - d.Digits = d.Digits[:i] - for p := 0; p < i; p++ { - i-- - d.Digits[p], d.Digits[i] = d.Digits[i], d.Digits[p] - } -} - -var scales [70]float64 - -func init() { - x := 1.0 - for i := range scales { - scales[i] = x - x *= 10 - } -} diff --git a/vendor/golang.org/x/text/internal/number/format.go b/vendor/golang.org/x/text/internal/number/format.go deleted file mode 100644 index cd94c5d..0000000 --- a/vendor/golang.org/x/text/internal/number/format.go +++ /dev/null @@ -1,535 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package number - -import ( - "strconv" - "unicode/utf8" - - "golang.org/x/text/language" -) - -// TODO: -// - grouping of fractions -// - allow user-defined superscript notation (such as 4) -// - same for non-breaking spaces, like   - -// A VisibleDigits computes digits, comma placement and trailing zeros as they -// will be shown to the user. -type VisibleDigits interface { - Digits(buf []byte, t language.Tag, scale int) Digits - // TODO: Do we also need to add the verb or pass a format.State? -} - -// Formatting proceeds along the following lines: -// 0) Compose rounding information from format and context. -// 1) Convert a number into a Decimal. -// 2) Sanitize Decimal by adding trailing zeros, removing leading digits, and -// (non-increment) rounding. The Decimal that results from this is suitable -// for determining the plural form. -// 3) Render the Decimal in the localized form. - -// Formatter contains all the information needed to render a number. -type Formatter struct { - Pattern - Info -} - -func (f *Formatter) init(t language.Tag, index []uint8) { - f.Info = InfoFromTag(t) - f.Pattern = formats[index[tagToID(t)]] -} - -// InitPattern initializes a Formatter for the given Pattern. -func (f *Formatter) InitPattern(t language.Tag, pat *Pattern) { - f.Info = InfoFromTag(t) - f.Pattern = *pat -} - -// InitDecimal initializes a Formatter using the default Pattern for the given -// language. -func (f *Formatter) InitDecimal(t language.Tag) { - f.init(t, tagToDecimal) -} - -// InitScientific initializes a Formatter using the default Pattern for the -// given language. -func (f *Formatter) InitScientific(t language.Tag) { - f.init(t, tagToScientific) - f.Pattern.MinFractionDigits = 0 - f.Pattern.MaxFractionDigits = -1 -} - -// InitEngineering initializes a Formatter using the default Pattern for the -// given language. -func (f *Formatter) InitEngineering(t language.Tag) { - f.init(t, tagToScientific) - f.Pattern.MinFractionDigits = 0 - f.Pattern.MaxFractionDigits = -1 - f.Pattern.MaxIntegerDigits = 3 - f.Pattern.MinIntegerDigits = 1 -} - -// InitPercent initializes a Formatter using the default Pattern for the given -// language. -func (f *Formatter) InitPercent(t language.Tag) { - f.init(t, tagToPercent) -} - -// InitPerMille initializes a Formatter using the default Pattern for the given -// language. -func (f *Formatter) InitPerMille(t language.Tag) { - f.init(t, tagToPercent) - f.Pattern.DigitShift = 3 -} - -func (f *Formatter) Append(dst []byte, x interface{}) []byte { - var d Decimal - r := f.RoundingContext - d.Convert(r, x) - return f.Render(dst, FormatDigits(&d, r)) -} - -func FormatDigits(d *Decimal, r RoundingContext) Digits { - if r.isScientific() { - return scientificVisibleDigits(r, d) - } - return decimalVisibleDigits(r, d) -} - -func (f *Formatter) Format(dst []byte, d *Decimal) []byte { - return f.Render(dst, FormatDigits(d, f.RoundingContext)) -} - -func (f *Formatter) Render(dst []byte, d Digits) []byte { - var result []byte - var postPrefix, preSuffix int - if d.IsScientific { - result, postPrefix, preSuffix = appendScientific(dst, f, &d) - } else { - result, postPrefix, preSuffix = appendDecimal(dst, f, &d) - } - if f.PadRune == 0 { - return result - } - width := int(f.FormatWidth) - if count := utf8.RuneCount(result); count < width { - insertPos := 0 - switch f.Flags & PadMask { - case PadAfterPrefix: - insertPos = postPrefix - case PadBeforeSuffix: - insertPos = preSuffix - case PadAfterSuffix: - insertPos = len(result) - } - num := width - count - pad := [utf8.UTFMax]byte{' '} - sz := 1 - if r := f.PadRune; r != 0 { - sz = utf8.EncodeRune(pad[:], r) - } - extra := sz * num - if n := len(result) + extra; n < cap(result) { - result = result[:n] - copy(result[insertPos+extra:], result[insertPos:]) - } else { - buf := make([]byte, n) - copy(buf, result[:insertPos]) - copy(buf[insertPos+extra:], result[insertPos:]) - result = buf - } - for ; num > 0; num-- { - insertPos += copy(result[insertPos:], pad[:sz]) - } - } - return result -} - -// decimalVisibleDigits converts d according to the RoundingContext. Note that -// the exponent may change as a result of this operation. -func decimalVisibleDigits(r RoundingContext, d *Decimal) Digits { - if d.NaN || d.Inf { - return Digits{digits: digits{Neg: d.Neg, NaN: d.NaN, Inf: d.Inf}} - } - n := Digits{digits: d.normalize().digits} - - exp := n.Exp - exp += int32(r.DigitShift) - - // Cap integer digits. Remove *most-significant* digits. - if r.MaxIntegerDigits > 0 { - if p := int(exp) - int(r.MaxIntegerDigits); p > 0 { - if p > len(n.Digits) { - p = len(n.Digits) - } - if n.Digits = n.Digits[p:]; len(n.Digits) == 0 { - exp = 0 - } else { - exp -= int32(p) - } - // Strip leading zeros. - for len(n.Digits) > 0 && n.Digits[0] == 0 { - n.Digits = n.Digits[1:] - exp-- - } - } - } - - // Rounding if not already done by Convert. - p := len(n.Digits) - if maxSig := int(r.MaxSignificantDigits); maxSig > 0 { - p = maxSig - } - if maxFrac := int(r.MaxFractionDigits); maxFrac >= 0 { - if cap := int(exp) + maxFrac; cap < p { - p = int(exp) + maxFrac - } - if p < 0 { - p = 0 - } - } - n.round(r.Mode, p) - - // set End (trailing zeros) - n.End = int32(len(n.Digits)) - if n.End == 0 { - exp = 0 - if r.MinFractionDigits > 0 { - n.End = int32(r.MinFractionDigits) - } - if p := int32(r.MinSignificantDigits) - 1; p > n.End { - n.End = p - } - } else { - if end := exp + int32(r.MinFractionDigits); end > n.End { - n.End = end - } - if n.End < int32(r.MinSignificantDigits) { - n.End = int32(r.MinSignificantDigits) - } - } - n.Exp = exp - return n -} - -// appendDecimal appends a formatted number to dst. It returns two possible -// insertion points for padding. -func appendDecimal(dst []byte, f *Formatter, n *Digits) (b []byte, postPre, preSuf int) { - if dst, ok := f.renderSpecial(dst, n); ok { - return dst, 0, len(dst) - } - digits := n.Digits - exp := n.Exp - - // Split in integer and fraction part. - var intDigits, fracDigits []byte - numInt := 0 - numFrac := int(n.End - n.Exp) - if exp > 0 { - numInt = int(exp) - if int(exp) >= len(digits) { // ddddd | ddddd00 - intDigits = digits - } else { // ddd.dd - intDigits = digits[:exp] - fracDigits = digits[exp:] - } - } else { - fracDigits = digits - } - - neg := n.Neg - affix, suffix := f.getAffixes(neg) - dst = appendAffix(dst, f, affix, neg) - savedLen := len(dst) - - minInt := int(f.MinIntegerDigits) - if minInt == 0 && f.MinSignificantDigits > 0 { - minInt = 1 - } - // add leading zeros - for i := minInt; i > numInt; i-- { - dst = f.AppendDigit(dst, 0) - if f.needsSep(i) { - dst = append(dst, f.Symbol(SymGroup)...) - } - } - i := 0 - for ; i < len(intDigits); i++ { - dst = f.AppendDigit(dst, intDigits[i]) - if f.needsSep(numInt - i) { - dst = append(dst, f.Symbol(SymGroup)...) - } - } - for ; i < numInt; i++ { - dst = f.AppendDigit(dst, 0) - if f.needsSep(numInt - i) { - dst = append(dst, f.Symbol(SymGroup)...) - } - } - - if numFrac > 0 || f.Flags&AlwaysDecimalSeparator != 0 { - dst = append(dst, f.Symbol(SymDecimal)...) - } - // Add trailing zeros - i = 0 - for n := -int(n.Exp); i < n; i++ { - dst = f.AppendDigit(dst, 0) - } - for _, d := range fracDigits { - i++ - dst = f.AppendDigit(dst, d) - } - for ; i < numFrac; i++ { - dst = f.AppendDigit(dst, 0) - } - return appendAffix(dst, f, suffix, neg), savedLen, len(dst) -} - -func scientificVisibleDigits(r RoundingContext, d *Decimal) Digits { - if d.NaN || d.Inf { - return Digits{digits: digits{Neg: d.Neg, NaN: d.NaN, Inf: d.Inf}} - } - n := Digits{digits: d.normalize().digits, IsScientific: true} - - // Normalize to have at least one digit. This simplifies engineering - // notation. - if len(n.Digits) == 0 { - n.Digits = append(n.Digits, 0) - n.Exp = 1 - } - - // Significant digits are transformed by the parser for scientific notation - // and do not need to be handled here. - maxInt, numInt := int(r.MaxIntegerDigits), int(r.MinIntegerDigits) - if numInt == 0 { - numInt = 1 - } - - // If a maximum number of integers is specified, the minimum must be 1 - // and the exponent is grouped by this number (e.g. for engineering) - if maxInt > numInt { - // Correct the exponent to reflect a single integer digit. - numInt = 1 - // engineering - // 0.01234 ([12345]e-1) -> 1.2345e-2 12.345e-3 - // 12345 ([12345]e+5) -> 1.2345e4 12.345e3 - d := int(n.Exp-1) % maxInt - if d < 0 { - d += maxInt - } - numInt += d - } - - p := len(n.Digits) - if maxSig := int(r.MaxSignificantDigits); maxSig > 0 { - p = maxSig - } - if maxFrac := int(r.MaxFractionDigits); maxFrac >= 0 && numInt+maxFrac < p { - p = numInt + maxFrac - } - n.round(r.Mode, p) - - n.Comma = uint8(numInt) - n.End = int32(len(n.Digits)) - if minSig := int32(r.MinFractionDigits) + int32(numInt); n.End < minSig { - n.End = minSig - } - return n -} - -// appendScientific appends a formatted number to dst. It returns two possible -// insertion points for padding. -func appendScientific(dst []byte, f *Formatter, n *Digits) (b []byte, postPre, preSuf int) { - if dst, ok := f.renderSpecial(dst, n); ok { - return dst, 0, 0 - } - digits := n.Digits - numInt := int(n.Comma) - numFrac := int(n.End) - int(n.Comma) - - var intDigits, fracDigits []byte - if numInt <= len(digits) { - intDigits = digits[:numInt] - fracDigits = digits[numInt:] - } else { - intDigits = digits - } - neg := n.Neg - affix, suffix := f.getAffixes(neg) - dst = appendAffix(dst, f, affix, neg) - savedLen := len(dst) - - i := 0 - for ; i < len(intDigits); i++ { - dst = f.AppendDigit(dst, intDigits[i]) - if f.needsSep(numInt - i) { - dst = append(dst, f.Symbol(SymGroup)...) - } - } - for ; i < numInt; i++ { - dst = f.AppendDigit(dst, 0) - if f.needsSep(numInt - i) { - dst = append(dst, f.Symbol(SymGroup)...) - } - } - - if numFrac > 0 || f.Flags&AlwaysDecimalSeparator != 0 { - dst = append(dst, f.Symbol(SymDecimal)...) - } - i = 0 - for ; i < len(fracDigits); i++ { - dst = f.AppendDigit(dst, fracDigits[i]) - } - for ; i < numFrac; i++ { - dst = f.AppendDigit(dst, 0) - } - - // exp - buf := [12]byte{} - // TODO: use exponential if superscripting is not available (no Latin - // numbers or no tags) and use exponential in all other cases. - exp := n.Exp - int32(n.Comma) - exponential := f.Symbol(SymExponential) - if exponential == "E" { - dst = append(dst, "\u202f"...) // NARROW NO-BREAK SPACE - dst = append(dst, f.Symbol(SymSuperscriptingExponent)...) - dst = append(dst, "\u202f"...) // NARROW NO-BREAK SPACE - dst = f.AppendDigit(dst, 1) - dst = f.AppendDigit(dst, 0) - switch { - case exp < 0: - dst = append(dst, superMinus...) - exp = -exp - case f.Flags&AlwaysExpSign != 0: - dst = append(dst, superPlus...) - } - b = strconv.AppendUint(buf[:0], uint64(exp), 10) - for i := len(b); i < int(f.MinExponentDigits); i++ { - dst = append(dst, superDigits[0]...) - } - for _, c := range b { - dst = append(dst, superDigits[c-'0']...) - } - } else { - dst = append(dst, exponential...) - switch { - case exp < 0: - dst = append(dst, f.Symbol(SymMinusSign)...) - exp = -exp - case f.Flags&AlwaysExpSign != 0: - dst = append(dst, f.Symbol(SymPlusSign)...) - } - b = strconv.AppendUint(buf[:0], uint64(exp), 10) - for i := len(b); i < int(f.MinExponentDigits); i++ { - dst = f.AppendDigit(dst, 0) - } - for _, c := range b { - dst = f.AppendDigit(dst, c-'0') - } - } - return appendAffix(dst, f, suffix, neg), savedLen, len(dst) -} - -const ( - superMinus = "\u207B" // SUPERSCRIPT HYPHEN-MINUS - superPlus = "\u207A" // SUPERSCRIPT PLUS SIGN -) - -var ( - // Note: the digits are not sequential!!! - superDigits = []string{ - "\u2070", // SUPERSCRIPT DIGIT ZERO - "\u00B9", // SUPERSCRIPT DIGIT ONE - "\u00B2", // SUPERSCRIPT DIGIT TWO - "\u00B3", // SUPERSCRIPT DIGIT THREE - "\u2074", // SUPERSCRIPT DIGIT FOUR - "\u2075", // SUPERSCRIPT DIGIT FIVE - "\u2076", // SUPERSCRIPT DIGIT SIX - "\u2077", // SUPERSCRIPT DIGIT SEVEN - "\u2078", // SUPERSCRIPT DIGIT EIGHT - "\u2079", // SUPERSCRIPT DIGIT NINE - } -) - -func (f *Formatter) getAffixes(neg bool) (affix, suffix string) { - str := f.Affix - if str != "" { - if f.NegOffset > 0 { - if neg { - str = str[f.NegOffset:] - } else { - str = str[:f.NegOffset] - } - } - sufStart := 1 + str[0] - affix = str[1:sufStart] - suffix = str[sufStart+1:] - } - // TODO: introduce a NeedNeg sign to indicate if the left pattern already - // has a sign marked? - if f.NegOffset == 0 && (neg || f.Flags&AlwaysSign != 0) { - affix = "-" + affix - } - return affix, suffix -} - -func (f *Formatter) renderSpecial(dst []byte, d *Digits) (b []byte, ok bool) { - if d.NaN { - return fmtNaN(dst, f), true - } - if d.Inf { - return fmtInfinite(dst, f, d), true - } - return dst, false -} - -func fmtNaN(dst []byte, f *Formatter) []byte { - return append(dst, f.Symbol(SymNan)...) -} - -func fmtInfinite(dst []byte, f *Formatter, d *Digits) []byte { - affix, suffix := f.getAffixes(d.Neg) - dst = appendAffix(dst, f, affix, d.Neg) - dst = append(dst, f.Symbol(SymInfinity)...) - dst = appendAffix(dst, f, suffix, d.Neg) - return dst -} - -func appendAffix(dst []byte, f *Formatter, affix string, neg bool) []byte { - quoting := false - escaping := false - for _, r := range affix { - switch { - case escaping: - // escaping occurs both inside and outside of quotes - dst = append(dst, string(r)...) - escaping = false - case r == '\\': - escaping = true - case r == '\'': - quoting = !quoting - case quoting: - dst = append(dst, string(r)...) - case r == '%': - if f.DigitShift == 3 { - dst = append(dst, f.Symbol(SymPerMille)...) - } else { - dst = append(dst, f.Symbol(SymPercentSign)...) - } - case r == '-' || r == '+': - if neg { - dst = append(dst, f.Symbol(SymMinusSign)...) - } else if f.Flags&ElideSign == 0 { - dst = append(dst, f.Symbol(SymPlusSign)...) - } else { - dst = append(dst, ' ') - } - default: - dst = append(dst, string(r)...) - } - } - return dst -} diff --git a/vendor/golang.org/x/text/internal/number/number.go b/vendor/golang.org/x/text/internal/number/number.go deleted file mode 100644 index e1d933c..0000000 --- a/vendor/golang.org/x/text/internal/number/number.go +++ /dev/null @@ -1,152 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_common.go - -// Package number contains tools and data for formatting numbers. -package number - -import ( - "unicode/utf8" - - "golang.org/x/text/internal/language/compact" - "golang.org/x/text/language" -) - -// Info holds number formatting configuration data. -type Info struct { - system systemData // numbering system information - symIndex symOffset // index to symbols -} - -// InfoFromLangID returns a Info for the given compact language identifier and -// numbering system identifier. If system is the empty string, the default -// numbering system will be taken for that language. -func InfoFromLangID(compactIndex compact.ID, numberSystem string) Info { - p := langToDefaults[compactIndex] - // Lookup the entry for the language. - pSymIndex := symOffset(0) // Default: Latin, default symbols - system, ok := systemMap[numberSystem] - if !ok { - // Take the value for the default numbering system. This is by far the - // most common case as an alternative numbering system is hardly used. - if p&hasNonLatnMask == 0 { // Latn digits. - pSymIndex = p - } else { // Non-Latn or multiple numbering systems. - // Take the first entry from the alternatives list. - data := langToAlt[p&^hasNonLatnMask] - pSymIndex = data.symIndex - system = data.system - } - } else { - langIndex := compactIndex - ns := system - outerLoop: - for ; ; p = langToDefaults[langIndex] { - if p&hasNonLatnMask == 0 { - if ns == 0 { - // The index directly points to the symbol data. - pSymIndex = p - break - } - // Move to the parent and retry. - langIndex = langIndex.Parent() - } else { - // The index points to a list of symbol data indexes. - for _, e := range langToAlt[p&^hasNonLatnMask:] { - if e.compactTag != langIndex { - if langIndex == 0 { - // The CLDR root defines full symbol information for - // all numbering systems (even though mostly by - // means of aliases). Fall back to the default entry - // for Latn if there is no data for the numbering - // system of this language. - if ns == 0 { - break - } - // Fall back to Latin and start from the original - // language. See - // https://unicode.org/reports/tr35/#Locale_Inheritance. - ns = numLatn - langIndex = compactIndex - continue outerLoop - } - // Fall back to parent. - langIndex = langIndex.Parent() - } else if e.system == ns { - pSymIndex = e.symIndex - break outerLoop - } - } - } - } - } - if int(system) >= len(numSysData) { // algorithmic - // Will generate ASCII digits in case the user inadvertently calls - // WriteDigit or Digit on it. - d := numSysData[0] - d.id = system - return Info{ - system: d, - symIndex: pSymIndex, - } - } - return Info{ - system: numSysData[system], - symIndex: pSymIndex, - } -} - -// InfoFromTag returns a Info for the given language tag. -func InfoFromTag(t language.Tag) Info { - return InfoFromLangID(tagToID(t), t.TypeForKey("nu")) -} - -// IsDecimal reports if the numbering system can convert decimal to native -// symbols one-to-one. -func (n Info) IsDecimal() bool { - return int(n.system.id) < len(numSysData) -} - -// WriteDigit writes the UTF-8 sequence for n corresponding to the given ASCII -// digit to dst and reports the number of bytes written. dst must be large -// enough to hold the rune (can be up to utf8.UTFMax bytes). -func (n Info) WriteDigit(dst []byte, asciiDigit rune) int { - copy(dst, n.system.zero[:n.system.digitSize]) - dst[n.system.digitSize-1] += byte(asciiDigit - '0') - return int(n.system.digitSize) -} - -// AppendDigit appends the UTF-8 sequence for n corresponding to the given digit -// to dst and reports the number of bytes written. dst must be large enough to -// hold the rune (can be up to utf8.UTFMax bytes). -func (n Info) AppendDigit(dst []byte, digit byte) []byte { - dst = append(dst, n.system.zero[:n.system.digitSize]...) - dst[len(dst)-1] += digit - return dst -} - -// Digit returns the digit for the numbering system for the corresponding ASCII -// value. For example, ni.Digit('3') could return '三'. Note that the argument -// is the rune constant '3', which equals 51, not the integer constant 3. -func (n Info) Digit(asciiDigit rune) rune { - var x [utf8.UTFMax]byte - n.WriteDigit(x[:], asciiDigit) - r, _ := utf8.DecodeRune(x[:]) - return r -} - -// Symbol returns the string for the given symbol type. -func (n Info) Symbol(t SymbolType) string { - return symData.Elem(int(symIndex[n.symIndex][t])) -} - -func formatForLang(t language.Tag, index []byte) *Pattern { - return &formats[index[tagToID(t)]] -} - -func tagToID(t language.Tag) compact.ID { - id, _ := compact.RegionalID(compact.Tag(t)) - return id -} diff --git a/vendor/golang.org/x/text/internal/number/pattern.go b/vendor/golang.org/x/text/internal/number/pattern.go deleted file mode 100644 index 06e5955..0000000 --- a/vendor/golang.org/x/text/internal/number/pattern.go +++ /dev/null @@ -1,485 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package number - -import ( - "errors" - "unicode/utf8" -) - -// This file contains a parser for the CLDR number patterns as described in -// https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns. -// -// The following BNF is derived from this standard. -// -// pattern := subpattern (';' subpattern)? -// subpattern := affix? number exponent? affix? -// number := decimal | sigDigits -// decimal := '#'* '0'* ('.' fraction)? | '#' | '0' -// fraction := '0'* '#'* -// sigDigits := '#'* '@' '@'* '#'* -// exponent := 'E' '+'? '0'* '0' -// padSpec := '*' \L -// -// Notes: -// - An affix pattern may contain any runes, but runes with special meaning -// should be escaped. -// - Sequences of digits, '#', and '@' in decimal and sigDigits may have -// interstitial commas. - -// TODO: replace special characters in affixes (-, +, ¤) with control codes. - -// Pattern holds information for formatting numbers. It is designed to hold -// information from CLDR number patterns. -// -// This pattern is precompiled for all patterns for all languages. Even though -// the number of patterns is not very large, we want to keep this small. -// -// This type is only intended for internal use. -type Pattern struct { - RoundingContext - - Affix string // includes prefix and suffix. First byte is prefix length. - Offset uint16 // Offset into Affix for prefix and suffix - NegOffset uint16 // Offset into Affix for negative prefix and suffix or 0. - PadRune rune - FormatWidth uint16 - - GroupingSize [2]uint8 - Flags PatternFlag -} - -// A RoundingContext indicates how a number should be converted to digits. -// It contains all information needed to determine the "visible digits" as -// required by the pluralization rules. -type RoundingContext struct { - // TODO: unify these two fields so that there is a more unambiguous meaning - // of how precision is handled. - MaxSignificantDigits int16 // -1 is unlimited - MaxFractionDigits int16 // -1 is unlimited - - Increment uint32 - IncrementScale uint8 // May differ from printed scale. - - Mode RoundingMode - - DigitShift uint8 // Number of decimals to shift. Used for % and ‰. - - // Number of digits. - MinIntegerDigits uint8 - - MaxIntegerDigits uint8 - MinFractionDigits uint8 - MinSignificantDigits uint8 - - MinExponentDigits uint8 -} - -// RoundSignificantDigits returns the number of significant digits an -// implementation of Convert may round to or n < 0 if there is no maximum or -// a maximum is not recommended. -func (r *RoundingContext) RoundSignificantDigits() (n int) { - if r.MaxFractionDigits == 0 && r.MaxSignificantDigits > 0 { - return int(r.MaxSignificantDigits) - } else if r.isScientific() && r.MaxIntegerDigits == 1 { - if r.MaxSignificantDigits == 0 || - int(r.MaxFractionDigits+1) == int(r.MaxSignificantDigits) { - // Note: don't add DigitShift: it is only used for decimals. - return int(r.MaxFractionDigits) + 1 - } - } - return -1 -} - -// RoundFractionDigits returns the number of fraction digits an implementation -// of Convert may round to or n < 0 if there is no maximum or a maximum is not -// recommended. -func (r *RoundingContext) RoundFractionDigits() (n int) { - if r.MinExponentDigits == 0 && - r.MaxSignificantDigits == 0 && - r.MaxFractionDigits >= 0 { - return int(r.MaxFractionDigits) + int(r.DigitShift) - } - return -1 -} - -// SetScale fixes the RoundingContext to a fixed number of fraction digits. -func (r *RoundingContext) SetScale(scale int) { - r.MinFractionDigits = uint8(scale) - r.MaxFractionDigits = int16(scale) -} - -func (r *RoundingContext) SetPrecision(prec int) { - r.MaxSignificantDigits = int16(prec) -} - -func (r *RoundingContext) isScientific() bool { - return r.MinExponentDigits > 0 -} - -func (f *Pattern) needsSep(pos int) bool { - p := pos - 1 - size := int(f.GroupingSize[0]) - if size == 0 || p == 0 { - return false - } - if p == size { - return true - } - if p -= size; p < 0 { - return false - } - // TODO: make second groupingsize the same as first if 0 so that we can - // avoid this check. - if x := int(f.GroupingSize[1]); x != 0 { - size = x - } - return p%size == 0 -} - -// A PatternFlag is a bit mask for the flag field of a Pattern. -type PatternFlag uint8 - -const ( - AlwaysSign PatternFlag = 1 << iota - ElideSign // Use space instead of plus sign. AlwaysSign must be true. - AlwaysExpSign - AlwaysDecimalSeparator - ParenthesisForNegative // Common pattern. Saves space. - - PadAfterNumber - PadAfterAffix - - PadBeforePrefix = 0 // Default - PadAfterPrefix = PadAfterAffix - PadBeforeSuffix = PadAfterNumber - PadAfterSuffix = PadAfterNumber | PadAfterAffix - PadMask = PadAfterNumber | PadAfterAffix -) - -type parser struct { - *Pattern - - leadingSharps int - - pos int - err error - doNotTerminate bool - groupingCount uint - hasGroup bool - buf []byte -} - -func (p *parser) setError(err error) { - if p.err == nil { - p.err = err - } -} - -func (p *parser) updateGrouping() { - if p.hasGroup && - 0 < p.groupingCount && p.groupingCount < 255 { - p.GroupingSize[1] = p.GroupingSize[0] - p.GroupingSize[0] = uint8(p.groupingCount) - } - p.groupingCount = 0 - p.hasGroup = true -} - -var ( - // TODO: more sensible and localizeable error messages. - errMultiplePadSpecifiers = errors.New("format: pattern has multiple pad specifiers") - errInvalidPadSpecifier = errors.New("format: invalid pad specifier") - errInvalidQuote = errors.New("format: invalid quote") - errAffixTooLarge = errors.New("format: prefix or suffix exceeds maximum UTF-8 length of 256 bytes") - errDuplicatePercentSign = errors.New("format: duplicate percent sign") - errDuplicatePermilleSign = errors.New("format: duplicate permille sign") - errUnexpectedEnd = errors.New("format: unexpected end of pattern") -) - -// ParsePattern extracts formatting information from a CLDR number pattern. -// -// See https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns. -func ParsePattern(s string) (f *Pattern, err error) { - p := parser{Pattern: &Pattern{}} - - s = p.parseSubPattern(s) - - if s != "" { - // Parse negative sub pattern. - if s[0] != ';' { - p.setError(errors.New("format: error parsing first sub pattern")) - return nil, p.err - } - neg := parser{Pattern: &Pattern{}} // just for extracting the affixes. - s = neg.parseSubPattern(s[len(";"):]) - p.NegOffset = uint16(len(p.buf)) - p.buf = append(p.buf, neg.buf...) - } - if s != "" { - p.setError(errors.New("format: spurious characters at end of pattern")) - } - if p.err != nil { - return nil, p.err - } - if affix := string(p.buf); affix == "\x00\x00" || affix == "\x00\x00\x00\x00" { - // No prefix or suffixes. - p.NegOffset = 0 - } else { - p.Affix = affix - } - if p.Increment == 0 { - p.IncrementScale = 0 - } - return p.Pattern, nil -} - -func (p *parser) parseSubPattern(s string) string { - s = p.parsePad(s, PadBeforePrefix) - s = p.parseAffix(s) - s = p.parsePad(s, PadAfterPrefix) - - s = p.parse(p.number, s) - p.updateGrouping() - - s = p.parsePad(s, PadBeforeSuffix) - s = p.parseAffix(s) - s = p.parsePad(s, PadAfterSuffix) - return s -} - -func (p *parser) parsePad(s string, f PatternFlag) (tail string) { - if len(s) >= 2 && s[0] == '*' { - r, sz := utf8.DecodeRuneInString(s[1:]) - if p.PadRune != 0 { - p.err = errMultiplePadSpecifiers - } else { - p.Flags |= f - p.PadRune = r - } - return s[1+sz:] - } - return s -} - -func (p *parser) parseAffix(s string) string { - x := len(p.buf) - p.buf = append(p.buf, 0) // placeholder for affix length - - s = p.parse(p.affix, s) - - n := len(p.buf) - x - 1 - if n > 0xFF { - p.setError(errAffixTooLarge) - } - p.buf[x] = uint8(n) - return s -} - -// state implements a state transition. It returns the new state. A state -// function may set an error on the parser or may simply return on an incorrect -// token and let the next phase fail. -type state func(r rune) state - -// parse repeatedly applies a state function on the given string until a -// termination condition is reached. -func (p *parser) parse(fn state, s string) (tail string) { - for i, r := range s { - p.doNotTerminate = false - if fn = fn(r); fn == nil || p.err != nil { - return s[i:] - } - p.FormatWidth++ - } - if p.doNotTerminate { - p.setError(errUnexpectedEnd) - } - return "" -} - -func (p *parser) affix(r rune) state { - switch r { - case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9', - '#', '@', '.', '*', ',', ';': - return nil - case '\'': - p.FormatWidth-- - return p.escapeFirst - case '%': - if p.DigitShift != 0 { - p.setError(errDuplicatePercentSign) - } - p.DigitShift = 2 - case '\u2030': // ‰ Per mille - if p.DigitShift != 0 { - p.setError(errDuplicatePermilleSign) - } - p.DigitShift = 3 - // TODO: handle currency somehow: ¤, ¤¤, ¤¤¤, ¤¤¤¤ - } - p.buf = append(p.buf, string(r)...) - return p.affix -} - -func (p *parser) escapeFirst(r rune) state { - switch r { - case '\'': - p.buf = append(p.buf, "\\'"...) - return p.affix - default: - p.buf = append(p.buf, '\'') - p.buf = append(p.buf, string(r)...) - } - return p.escape -} - -func (p *parser) escape(r rune) state { - switch r { - case '\'': - p.FormatWidth-- - p.buf = append(p.buf, '\'') - return p.affix - default: - p.buf = append(p.buf, string(r)...) - } - return p.escape -} - -// number parses a number. The BNF says the integer part should always have -// a '0', but that does not appear to be the case according to the rest of the -// documentation. We will allow having only '#' numbers. -func (p *parser) number(r rune) state { - switch r { - case '#': - p.groupingCount++ - p.leadingSharps++ - case '@': - p.groupingCount++ - p.leadingSharps = 0 - p.MaxFractionDigits = -1 - return p.sigDigits(r) - case ',': - if p.leadingSharps == 0 { // no leading commas - return nil - } - p.updateGrouping() - case 'E': - p.MaxIntegerDigits = uint8(p.leadingSharps) - return p.exponent - case '.': // allow ".##" etc. - p.updateGrouping() - return p.fraction - case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': - return p.integer(r) - default: - return nil - } - return p.number -} - -func (p *parser) integer(r rune) state { - if !('0' <= r && r <= '9') { - var next state - switch r { - case 'E': - if p.leadingSharps > 0 { - p.MaxIntegerDigits = uint8(p.leadingSharps) + p.MinIntegerDigits - } - next = p.exponent - case '.': - next = p.fraction - case ',': - next = p.integer - } - p.updateGrouping() - return next - } - p.Increment = p.Increment*10 + uint32(r-'0') - p.groupingCount++ - p.MinIntegerDigits++ - return p.integer -} - -func (p *parser) sigDigits(r rune) state { - switch r { - case '@': - p.groupingCount++ - p.MaxSignificantDigits++ - p.MinSignificantDigits++ - case '#': - return p.sigDigitsFinal(r) - case 'E': - p.updateGrouping() - return p.normalizeSigDigitsWithExponent() - default: - p.updateGrouping() - return nil - } - return p.sigDigits -} - -func (p *parser) sigDigitsFinal(r rune) state { - switch r { - case '#': - p.groupingCount++ - p.MaxSignificantDigits++ - case 'E': - p.updateGrouping() - return p.normalizeSigDigitsWithExponent() - default: - p.updateGrouping() - return nil - } - return p.sigDigitsFinal -} - -func (p *parser) normalizeSigDigitsWithExponent() state { - p.MinIntegerDigits, p.MaxIntegerDigits = 1, 1 - p.MinFractionDigits = p.MinSignificantDigits - 1 - p.MaxFractionDigits = p.MaxSignificantDigits - 1 - p.MinSignificantDigits, p.MaxSignificantDigits = 0, 0 - return p.exponent -} - -func (p *parser) fraction(r rune) state { - switch r { - case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': - p.Increment = p.Increment*10 + uint32(r-'0') - p.IncrementScale++ - p.MinFractionDigits++ - p.MaxFractionDigits++ - case '#': - p.MaxFractionDigits++ - case 'E': - if p.leadingSharps > 0 { - p.MaxIntegerDigits = uint8(p.leadingSharps) + p.MinIntegerDigits - } - return p.exponent - default: - return nil - } - return p.fraction -} - -func (p *parser) exponent(r rune) state { - switch r { - case '+': - // Set mode and check it wasn't already set. - if p.Flags&AlwaysExpSign != 0 || p.MinExponentDigits > 0 { - break - } - p.Flags |= AlwaysExpSign - p.doNotTerminate = true - return p.exponent - case '0': - p.MinExponentDigits++ - return p.exponent - } - // termination condition - if p.MinExponentDigits == 0 { - p.setError(errors.New("format: need at least one digit")) - } - return nil -} diff --git a/vendor/golang.org/x/text/internal/number/roundingmode_string.go b/vendor/golang.org/x/text/internal/number/roundingmode_string.go deleted file mode 100644 index bcc2247..0000000 --- a/vendor/golang.org/x/text/internal/number/roundingmode_string.go +++ /dev/null @@ -1,30 +0,0 @@ -// Code generated by "stringer -type RoundingMode"; DO NOT EDIT. - -package number - -import "strconv" - -func _() { - // An "invalid array index" compiler error signifies that the constant values have changed. - // Re-run the stringer command to generate them again. - var x [1]struct{} - _ = x[ToNearestEven-0] - _ = x[ToNearestZero-1] - _ = x[ToNearestAway-2] - _ = x[ToPositiveInf-3] - _ = x[ToNegativeInf-4] - _ = x[ToZero-5] - _ = x[AwayFromZero-6] - _ = x[numModes-7] -} - -const _RoundingMode_name = "ToNearestEvenToNearestZeroToNearestAwayToPositiveInfToNegativeInfToZeroAwayFromZeronumModes" - -var _RoundingMode_index = [...]uint8{0, 13, 26, 39, 52, 65, 71, 83, 91} - -func (i RoundingMode) String() string { - if i >= RoundingMode(len(_RoundingMode_index)-1) { - return "RoundingMode(" + strconv.FormatInt(int64(i), 10) + ")" - } - return _RoundingMode_name[_RoundingMode_index[i]:_RoundingMode_index[i+1]] -} diff --git a/vendor/golang.org/x/text/internal/number/tables.go b/vendor/golang.org/x/text/internal/number/tables.go deleted file mode 100644 index 8efce81..0000000 --- a/vendor/golang.org/x/text/internal/number/tables.go +++ /dev/null @@ -1,1219 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package number - -import "golang.org/x/text/internal/stringset" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -var numSysData = []systemData{ // 59 elements - 0: {id: 0x0, digitSize: 0x1, zero: [4]uint8{0x30, 0x0, 0x0, 0x0}}, - 1: {id: 0x1, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9e, 0xa5, 0x90}}, - 2: {id: 0x2, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x9c, 0xb0}}, - 3: {id: 0x3, digitSize: 0x2, zero: [4]uint8{0xd9, 0xa0, 0x0, 0x0}}, - 4: {id: 0x4, digitSize: 0x2, zero: [4]uint8{0xdb, 0xb0, 0x0, 0x0}}, - 5: {id: 0x5, digitSize: 0x3, zero: [4]uint8{0xe1, 0xad, 0x90, 0x0}}, - 6: {id: 0x6, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa7, 0xa6, 0x0}}, - 7: {id: 0x7, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xb1, 0x90}}, - 8: {id: 0x8, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x81, 0xa6}}, - 9: {id: 0x9, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x84, 0xb6}}, - 10: {id: 0xa, digitSize: 0x3, zero: [4]uint8{0xea, 0xa9, 0x90, 0x0}}, - 11: {id: 0xb, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa5, 0xa6, 0x0}}, - 12: {id: 0xc, digitSize: 0x3, zero: [4]uint8{0xef, 0xbc, 0x90, 0x0}}, - 13: {id: 0xd, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xb5, 0x90}}, - 14: {id: 0xe, digitSize: 0x3, zero: [4]uint8{0xe0, 0xab, 0xa6, 0x0}}, - 15: {id: 0xf, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa9, 0xa6, 0x0}}, - 16: {id: 0x10, digitSize: 0x4, zero: [4]uint8{0xf0, 0x96, 0xad, 0x90}}, - 17: {id: 0x11, digitSize: 0x3, zero: [4]uint8{0xea, 0xa7, 0x90, 0x0}}, - 18: {id: 0x12, digitSize: 0x3, zero: [4]uint8{0xea, 0xa4, 0x80, 0x0}}, - 19: {id: 0x13, digitSize: 0x3, zero: [4]uint8{0xe1, 0x9f, 0xa0, 0x0}}, - 20: {id: 0x14, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb3, 0xa6, 0x0}}, - 21: {id: 0x15, digitSize: 0x3, zero: [4]uint8{0xe1, 0xaa, 0x80, 0x0}}, - 22: {id: 0x16, digitSize: 0x3, zero: [4]uint8{0xe1, 0xaa, 0x90, 0x0}}, - 23: {id: 0x17, digitSize: 0x3, zero: [4]uint8{0xe0, 0xbb, 0x90, 0x0}}, - 24: {id: 0x18, digitSize: 0x3, zero: [4]uint8{0xe1, 0xb1, 0x80, 0x0}}, - 25: {id: 0x19, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa5, 0x86, 0x0}}, - 26: {id: 0x1a, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0x8e}}, - 27: {id: 0x1b, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0x98}}, - 28: {id: 0x1c, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xb6}}, - 29: {id: 0x1d, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xac}}, - 30: {id: 0x1e, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xa2}}, - 31: {id: 0x1f, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb5, 0xa6, 0x0}}, - 32: {id: 0x20, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x99, 0x90}}, - 33: {id: 0x21, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa0, 0x90, 0x0}}, - 34: {id: 0x22, digitSize: 0x4, zero: [4]uint8{0xf0, 0x96, 0xa9, 0xa0}}, - 35: {id: 0x23, digitSize: 0x3, zero: [4]uint8{0xea, 0xaf, 0xb0, 0x0}}, - 36: {id: 0x24, digitSize: 0x3, zero: [4]uint8{0xe1, 0x81, 0x80, 0x0}}, - 37: {id: 0x25, digitSize: 0x3, zero: [4]uint8{0xe1, 0x82, 0x90, 0x0}}, - 38: {id: 0x26, digitSize: 0x3, zero: [4]uint8{0xea, 0xa7, 0xb0, 0x0}}, - 39: {id: 0x27, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x91, 0x90}}, - 40: {id: 0x28, digitSize: 0x2, zero: [4]uint8{0xdf, 0x80, 0x0, 0x0}}, - 41: {id: 0x29, digitSize: 0x3, zero: [4]uint8{0xe1, 0xb1, 0x90, 0x0}}, - 42: {id: 0x2a, digitSize: 0x3, zero: [4]uint8{0xe0, 0xad, 0xa6, 0x0}}, - 43: {id: 0x2b, digitSize: 0x4, zero: [4]uint8{0xf0, 0x90, 0x92, 0xa0}}, - 44: {id: 0x2c, digitSize: 0x3, zero: [4]uint8{0xea, 0xa3, 0x90, 0x0}}, - 45: {id: 0x2d, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x87, 0x90}}, - 46: {id: 0x2e, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x8b, 0xb0}}, - 47: {id: 0x2f, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb7, 0xa6, 0x0}}, - 48: {id: 0x30, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x83, 0xb0}}, - 49: {id: 0x31, digitSize: 0x3, zero: [4]uint8{0xe1, 0xae, 0xb0, 0x0}}, - 50: {id: 0x32, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x9b, 0x80}}, - 51: {id: 0x33, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa7, 0x90, 0x0}}, - 52: {id: 0x34, digitSize: 0x3, zero: [4]uint8{0xe0, 0xaf, 0xa6, 0x0}}, - 53: {id: 0x35, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb1, 0xa6, 0x0}}, - 54: {id: 0x36, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb9, 0x90, 0x0}}, - 55: {id: 0x37, digitSize: 0x3, zero: [4]uint8{0xe0, 0xbc, 0xa0, 0x0}}, - 56: {id: 0x38, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x93, 0x90}}, - 57: {id: 0x39, digitSize: 0x3, zero: [4]uint8{0xea, 0x98, 0xa0, 0x0}}, - 58: {id: 0x3a, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xa3, 0xa0}}, -} // Size: 378 bytes - -const ( - numAdlm = 0x1 - numAhom = 0x2 - numArab = 0x3 - numArabext = 0x4 - numArmn = 0x3b - numArmnlow = 0x3c - numBali = 0x5 - numBeng = 0x6 - numBhks = 0x7 - numBrah = 0x8 - numCakm = 0x9 - numCham = 0xa - numCyrl = 0x3d - numDeva = 0xb - numEthi = 0x3e - numFullwide = 0xc - numGeor = 0x3f - numGonm = 0xd - numGrek = 0x40 - numGreklow = 0x41 - numGujr = 0xe - numGuru = 0xf - numHanidays = 0x42 - numHanidec = 0x43 - numHans = 0x44 - numHansfin = 0x45 - numHant = 0x46 - numHantfin = 0x47 - numHebr = 0x48 - numHmng = 0x10 - numJava = 0x11 - numJpan = 0x49 - numJpanfin = 0x4a - numKali = 0x12 - numKhmr = 0x13 - numKnda = 0x14 - numLana = 0x15 - numLanatham = 0x16 - numLaoo = 0x17 - numLatn = 0x0 - numLepc = 0x18 - numLimb = 0x19 - numMathbold = 0x1a - numMathdbl = 0x1b - numMathmono = 0x1c - numMathsanb = 0x1d - numMathsans = 0x1e - numMlym = 0x1f - numModi = 0x20 - numMong = 0x21 - numMroo = 0x22 - numMtei = 0x23 - numMymr = 0x24 - numMymrshan = 0x25 - numMymrtlng = 0x26 - numNewa = 0x27 - numNkoo = 0x28 - numOlck = 0x29 - numOrya = 0x2a - numOsma = 0x2b - numRoman = 0x4b - numRomanlow = 0x4c - numSaur = 0x2c - numShrd = 0x2d - numSind = 0x2e - numSinh = 0x2f - numSora = 0x30 - numSund = 0x31 - numTakr = 0x32 - numTalu = 0x33 - numTaml = 0x4d - numTamldec = 0x34 - numTelu = 0x35 - numThai = 0x36 - numTibt = 0x37 - numTirh = 0x38 - numVaii = 0x39 - numWara = 0x3a - numNumberSystems -) - -var systemMap = map[string]system{ - "adlm": numAdlm, - "ahom": numAhom, - "arab": numArab, - "arabext": numArabext, - "armn": numArmn, - "armnlow": numArmnlow, - "bali": numBali, - "beng": numBeng, - "bhks": numBhks, - "brah": numBrah, - "cakm": numCakm, - "cham": numCham, - "cyrl": numCyrl, - "deva": numDeva, - "ethi": numEthi, - "fullwide": numFullwide, - "geor": numGeor, - "gonm": numGonm, - "grek": numGrek, - "greklow": numGreklow, - "gujr": numGujr, - "guru": numGuru, - "hanidays": numHanidays, - "hanidec": numHanidec, - "hans": numHans, - "hansfin": numHansfin, - "hant": numHant, - "hantfin": numHantfin, - "hebr": numHebr, - "hmng": numHmng, - "java": numJava, - "jpan": numJpan, - "jpanfin": numJpanfin, - "kali": numKali, - "khmr": numKhmr, - "knda": numKnda, - "lana": numLana, - "lanatham": numLanatham, - "laoo": numLaoo, - "latn": numLatn, - "lepc": numLepc, - "limb": numLimb, - "mathbold": numMathbold, - "mathdbl": numMathdbl, - "mathmono": numMathmono, - "mathsanb": numMathsanb, - "mathsans": numMathsans, - "mlym": numMlym, - "modi": numModi, - "mong": numMong, - "mroo": numMroo, - "mtei": numMtei, - "mymr": numMymr, - "mymrshan": numMymrshan, - "mymrtlng": numMymrtlng, - "newa": numNewa, - "nkoo": numNkoo, - "olck": numOlck, - "orya": numOrya, - "osma": numOsma, - "roman": numRoman, - "romanlow": numRomanlow, - "saur": numSaur, - "shrd": numShrd, - "sind": numSind, - "sinh": numSinh, - "sora": numSora, - "sund": numSund, - "takr": numTakr, - "talu": numTalu, - "taml": numTaml, - "tamldec": numTamldec, - "telu": numTelu, - "thai": numThai, - "tibt": numTibt, - "tirh": numTirh, - "vaii": numVaii, - "wara": numWara, -} - -var symIndex = [][12]uint8{ // 81 elements - 0: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 1: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 2: [12]uint8{0x0, 0x1, 0x2, 0xd, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, - 3: [12]uint8{0x1, 0x0, 0x2, 0xd, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, - 4: [12]uint8{0x0, 0x1, 0x2, 0x11, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, - 5: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x12, 0xb}, - 6: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 7: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x13, 0xb}, - 8: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 9: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, - 10: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, - 11: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, - 12: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, - 13: [12]uint8{0x0, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 14: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x16, 0xb}, - 15: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, - 16: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0x0}, - 17: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, - 18: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, - 19: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x18, 0x7, 0x8, 0x9, 0xa, 0xb}, - 20: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x19, 0x1a, 0xa, 0xb}, - 21: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 22: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x7, 0x8, 0x9, 0xa, 0xb}, - 23: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 24: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0x1c, 0x6, 0x7, 0x8, 0x9, 0x1d, 0xb}, - 25: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0x1e, 0x0}, - 26: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 27: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 28: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x1f, 0xb}, - 29: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 30: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x20, 0xb}, - 31: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x21, 0x7, 0x8, 0x9, 0x22, 0xb}, - 32: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x23, 0xb}, - 33: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x14, 0x8, 0x9, 0x24, 0xb}, - 34: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x7, 0x8, 0x9, 0x24, 0xb}, - 35: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x25, 0xb}, - 36: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x26, 0xb}, - 37: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x27, 0xb}, - 38: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x28, 0xb}, - 39: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x29, 0xb}, - 40: [12]uint8{0x1, 0x0, 0x2, 0x3, 0xe, 0x1c, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 41: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2a, 0xb}, - 42: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2b, 0xb}, - 43: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x2c, 0x14, 0x8, 0x9, 0x24, 0xb}, - 44: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, - 45: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, - 46: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, - 47: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2d, 0x0}, - 48: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2e, 0xb}, - 49: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2f, 0xb}, - 50: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x30, 0x7, 0x8, 0x9, 0xa, 0xb}, - 51: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x31, 0xb}, - 52: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x32, 0xb}, - 53: [12]uint8{0x1, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, - 54: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x33, 0xb}, - 55: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x34, 0xb}, - 56: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, - 57: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0x3d, 0xb}, - 58: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, - 59: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, - 60: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x39, 0x40, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, - 61: [12]uint8{0x35, 0x36, 0x37, 0x41, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, - 62: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, - 63: [12]uint8{0x35, 0xc, 0x37, 0x38, 0x39, 0x42, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0x0}, - 64: [12]uint8{0x35, 0xc, 0x37, 0x38, 0x39, 0x42, 0x43, 0x7, 0x44, 0x9, 0x24, 0xb}, - 65: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x5, 0x3b, 0x7, 0x3c, 0x9, 0x33, 0xb}, - 66: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x45, 0x46, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, - 67: [12]uint8{0x35, 0x36, 0x37, 0x11, 0xe, 0x1c, 0x43, 0x7, 0x3c, 0x9, 0x1d, 0xb}, - 68: [12]uint8{0x35, 0x36, 0x37, 0x11, 0xe, 0x1c, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, - 69: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x45, 0x5, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, - 70: [12]uint8{0x1, 0xc, 0x37, 0x11, 0x45, 0x47, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x0}, - 71: [12]uint8{0x35, 0x1, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, - 72: [12]uint8{0x1, 0xc, 0x37, 0x11, 0x45, 0x47, 0x43, 0x7, 0x3c, 0x9, 0x24, 0xb}, - 73: [12]uint8{0x35, 0x36, 0x2, 0x3, 0x45, 0x46, 0x43, 0x7, 0x8, 0x9, 0xa, 0x35}, - 74: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0x31, 0x35}, - 75: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0x32, 0x35}, - 76: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x48, 0x46, 0x43, 0x7, 0x3c, 0x9, 0x33, 0x35}, - 77: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x49}, - 78: [12]uint8{0x0, 0x1, 0x4a, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x28, 0xb}, - 79: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x4b, 0xb}, - 80: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x4c, 0x4d, 0xb}, -} // Size: 996 bytes - -var symData = stringset.Set{ - Data: "" + // Size: 599 bytes - ".,;%+-E׉∞NaN:\u00a0\u200e%\u200e\u200e+\u200e-ليس\u00a0رقمًا٪NDТерхьаш" + - "\u00a0дац·’mnne×10^0/00INF−\u200e−ناعددepälukuՈչԹარ\u00a0არის\u00a0რიცხვ" + - "იZMdMсан\u00a0емес¤¤¤сан\u00a0эмесບໍ່\u200bແມ່ນ\u200bໂຕ\u200bເລກNSဂဏန်" + - "းမဟုတ်သောННне\u00a0числочыыһыла\u00a0буотах·10^epilohosan\u00a0dälTFЕs" + - "on\u00a0emasҳақиқий\u00a0сон\u00a0эмас非數值非数值٫٬؛٪\u061c\u061c+\u061c-اس؉ل" + - "يس\u00a0رقم\u200f+\u200f-\u200f−٪\u200f\u061c−×۱۰^؉\u200f\u200e+\u200e" + - "\u200e-\u200e\u200e−\u200e+\u200e:၊ཨང་མེན་གྲངས་མེདཨང་མད", - Index: []uint16{ // 79 elements - // Entry 0 - 3F - 0x0000, 0x0001, 0x0002, 0x0003, 0x0004, 0x0005, 0x0006, 0x0007, - 0x0009, 0x000c, 0x000f, 0x0012, 0x0013, 0x0015, 0x001c, 0x0020, - 0x0024, 0x0036, 0x0038, 0x003a, 0x0050, 0x0052, 0x0055, 0x0058, - 0x0059, 0x005e, 0x0062, 0x0065, 0x0068, 0x006e, 0x0078, 0x0080, - 0x0086, 0x00ae, 0x00af, 0x00b2, 0x00c2, 0x00c8, 0x00d8, 0x0105, - 0x0107, 0x012e, 0x0132, 0x0142, 0x015e, 0x0163, 0x016a, 0x0173, - 0x0175, 0x0177, 0x0180, 0x01a0, 0x01a9, 0x01b2, 0x01b4, 0x01b6, - 0x01b8, 0x01bc, 0x01bf, 0x01c2, 0x01c6, 0x01c8, 0x01d6, 0x01da, - // Entry 40 - 7F - 0x01de, 0x01e4, 0x01e9, 0x01ee, 0x01f5, 0x01fa, 0x0201, 0x0208, - 0x0211, 0x0215, 0x0218, 0x021b, 0x0230, 0x0248, 0x0257, - }, -} // Size: 797 bytes - -// langToDefaults maps a compact language index to the default numbering system -// and default symbol set -var langToDefaults = [775]symOffset{ - // Entry 0 - 3F - 0x8000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, 0x0000, - 0x0000, 0x0000, 0x8003, 0x0002, 0x0002, 0x0002, 0x0002, 0x0003, - 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, - 0x0003, 0x0003, 0x0003, 0x0003, 0x0002, 0x0002, 0x0002, 0x0004, - 0x0002, 0x0004, 0x0002, 0x0002, 0x0002, 0x0003, 0x0002, 0x0000, - 0x8005, 0x0000, 0x0000, 0x0000, 0x8006, 0x0005, 0x0006, 0x0006, - 0x0006, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, - // Entry 40 - 7F - 0x8009, 0x0000, 0x0000, 0x800a, 0x0000, 0x0000, 0x800c, 0x0001, - 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, - 0x0006, 0x0006, 0x0006, 0x0006, 0x800e, 0x0000, 0x0000, 0x0007, - 0x0007, 0x0000, 0x0000, 0x0000, 0x0000, 0x800f, 0x0008, 0x0008, - 0x8011, 0x0001, 0x0001, 0x0001, 0x803c, 0x0000, 0x0009, 0x0009, - 0x0009, 0x0000, 0x0000, 0x000a, 0x000b, 0x000a, 0x000c, 0x000a, - 0x000a, 0x000c, 0x000a, 0x000d, 0x000d, 0x000a, 0x000a, 0x0001, - 0x0001, 0x0000, 0x0001, 0x0001, 0x803f, 0x0000, 0x0000, 0x0000, - // Entry 80 - BF - 0x000e, 0x000e, 0x000e, 0x000f, 0x000f, 0x000f, 0x0000, 0x0000, - 0x0006, 0x0000, 0x0000, 0x0000, 0x000a, 0x0010, 0x0000, 0x0006, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0011, 0x0000, 0x000a, - 0x0000, 0x0000, 0x0000, 0x0000, 0x000a, 0x0000, 0x0009, 0x0000, - 0x0000, 0x0012, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - // Entry C0 - FF - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0013, 0x0000, - 0x0000, 0x000f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, 0x0000, 0x0000, 0x0015, - 0x0015, 0x0006, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, 0x0006, - 0x0006, 0x0001, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, - // Entry 100 - 13F - 0x0000, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, - 0x0000, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0016, 0x0016, - 0x0017, 0x0017, 0x0001, 0x0001, 0x8041, 0x0018, 0x0018, 0x0001, - 0x0001, 0x0001, 0x0001, 0x0001, 0x0019, 0x0019, 0x0000, 0x0000, - 0x0017, 0x0017, 0x0017, 0x8044, 0x0001, 0x0001, 0x0001, 0x0001, - 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, - 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, - 0x0001, 0x0001, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, - // Entry 140 - 17F - 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, - 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, - 0x0001, 0x0001, 0x0006, 0x0006, 0x0006, 0x0006, 0x0000, 0x0000, - 0x8047, 0x0000, 0x0006, 0x0006, 0x001a, 0x001a, 0x001a, 0x001a, - 0x804a, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x804c, 0x001b, 0x0000, - 0x0000, 0x0006, 0x0006, 0x0006, 0x000a, 0x000a, 0x0001, 0x0001, - 0x001c, 0x001c, 0x0009, 0x0009, 0x804f, 0x0000, 0x0000, 0x0000, - // Entry 180 - 1BF - 0x0000, 0x0000, 0x8052, 0x0006, 0x0006, 0x001d, 0x0006, 0x0006, - 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x001e, 0x001e, 0x001f, - 0x001f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, - 0x0001, 0x000d, 0x000d, 0x0000, 0x0000, 0x0020, 0x0020, 0x0006, - 0x0006, 0x0021, 0x0021, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, - 0x0000, 0x8054, 0x0000, 0x0000, 0x0000, 0x0000, 0x8056, 0x001b, - 0x0000, 0x0000, 0x0001, 0x0001, 0x0022, 0x0022, 0x0000, 0x0000, - // Entry 1C0 - 1FF - 0x0000, 0x0023, 0x0023, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, - 0x0024, 0x0024, 0x8058, 0x0000, 0x0000, 0x0016, 0x0016, 0x0006, - 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0025, 0x0025, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x000d, 0x000d, 0x0000, 0x0000, - 0x0006, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x805a, 0x0000, 0x0000, 0x0006, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x805b, 0x0026, 0x805d, - // Entry 200 - 23F - 0x0000, 0x0000, 0x0000, 0x0000, 0x805e, 0x0015, 0x0015, 0x0000, - 0x0000, 0x0006, 0x0006, 0x0006, 0x8061, 0x0000, 0x0000, 0x8062, - 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0001, - 0x0001, 0x0015, 0x0015, 0x0006, 0x0006, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0027, 0x0027, 0x0027, 0x8065, 0x8067, - 0x001b, 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, - 0x8069, 0x0028, 0x0006, 0x0001, 0x0006, 0x0001, 0x0001, 0x0001, - // Entry 240 - 27F - 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, - 0x0006, 0x0000, 0x0000, 0x001a, 0x001a, 0x0006, 0x0006, 0x0006, - 0x0006, 0x0006, 0x0000, 0x0000, 0x0029, 0x0029, 0x0029, 0x0029, - 0x0029, 0x0029, 0x0029, 0x0006, 0x0006, 0x0000, 0x0000, 0x002a, - 0x002a, 0x0000, 0x0000, 0x0000, 0x0000, 0x806b, 0x0000, 0x0000, - 0x002b, 0x002b, 0x002b, 0x002b, 0x0006, 0x0006, 0x000d, 0x000d, - 0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, - 0x002c, 0x002c, 0x002d, 0x002d, 0x002e, 0x002e, 0x0000, 0x0000, - // Entry 280 - 2BF - 0x0000, 0x002f, 0x002f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0006, - 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, - 0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x806d, 0x0022, 0x0022, - 0x0022, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0030, 0x0030, 0x0000, 0x0000, 0x8071, 0x0031, 0x0006, - // Entry 2C0 - 2FF - 0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x000d, 0x000d, 0x0001, - 0x0001, 0x0000, 0x0000, 0x0032, 0x0032, 0x8074, 0x8076, 0x001b, - 0x8077, 0x8079, 0x0028, 0x807b, 0x0034, 0x0033, 0x0033, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0035, 0x0035, 0x0006, 0x0006, - 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0036, 0x0037, 0x0037, 0x0036, 0x0036, 0x0001, - 0x0001, 0x807d, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x8080, - // Entry 300 - 33F - 0x0036, 0x0036, 0x0036, 0x0000, 0x0000, 0x0006, 0x0014, -} // Size: 1550 bytes - -// langToAlt is a list of numbering system and symbol set pairs, sorted and -// marked by compact language index. -var langToAlt = []altSymData{ // 131 elements - 1: {compactTag: 0x0, symIndex: 0x38, system: 0x3}, - 2: {compactTag: 0x0, symIndex: 0x42, system: 0x4}, - 3: {compactTag: 0xa, symIndex: 0x39, system: 0x3}, - 4: {compactTag: 0xa, symIndex: 0x2, system: 0x0}, - 5: {compactTag: 0x28, symIndex: 0x0, system: 0x6}, - 6: {compactTag: 0x2c, symIndex: 0x5, system: 0x0}, - 7: {compactTag: 0x2c, symIndex: 0x3a, system: 0x3}, - 8: {compactTag: 0x2c, symIndex: 0x42, system: 0x4}, - 9: {compactTag: 0x40, symIndex: 0x0, system: 0x6}, - 10: {compactTag: 0x43, symIndex: 0x0, system: 0x0}, - 11: {compactTag: 0x43, symIndex: 0x4f, system: 0x37}, - 12: {compactTag: 0x46, symIndex: 0x1, system: 0x0}, - 13: {compactTag: 0x46, symIndex: 0x38, system: 0x3}, - 14: {compactTag: 0x54, symIndex: 0x0, system: 0x9}, - 15: {compactTag: 0x5d, symIndex: 0x3a, system: 0x3}, - 16: {compactTag: 0x5d, symIndex: 0x8, system: 0x0}, - 17: {compactTag: 0x60, symIndex: 0x1, system: 0x0}, - 18: {compactTag: 0x60, symIndex: 0x38, system: 0x3}, - 19: {compactTag: 0x60, symIndex: 0x42, system: 0x4}, - 20: {compactTag: 0x60, symIndex: 0x0, system: 0x5}, - 21: {compactTag: 0x60, symIndex: 0x0, system: 0x6}, - 22: {compactTag: 0x60, symIndex: 0x0, system: 0x8}, - 23: {compactTag: 0x60, symIndex: 0x0, system: 0x9}, - 24: {compactTag: 0x60, symIndex: 0x0, system: 0xa}, - 25: {compactTag: 0x60, symIndex: 0x0, system: 0xb}, - 26: {compactTag: 0x60, symIndex: 0x0, system: 0xc}, - 27: {compactTag: 0x60, symIndex: 0x0, system: 0xd}, - 28: {compactTag: 0x60, symIndex: 0x0, system: 0xe}, - 29: {compactTag: 0x60, symIndex: 0x0, system: 0xf}, - 30: {compactTag: 0x60, symIndex: 0x0, system: 0x11}, - 31: {compactTag: 0x60, symIndex: 0x0, system: 0x12}, - 32: {compactTag: 0x60, symIndex: 0x0, system: 0x13}, - 33: {compactTag: 0x60, symIndex: 0x0, system: 0x14}, - 34: {compactTag: 0x60, symIndex: 0x0, system: 0x15}, - 35: {compactTag: 0x60, symIndex: 0x0, system: 0x16}, - 36: {compactTag: 0x60, symIndex: 0x0, system: 0x17}, - 37: {compactTag: 0x60, symIndex: 0x0, system: 0x18}, - 38: {compactTag: 0x60, symIndex: 0x0, system: 0x19}, - 39: {compactTag: 0x60, symIndex: 0x0, system: 0x1f}, - 40: {compactTag: 0x60, symIndex: 0x0, system: 0x21}, - 41: {compactTag: 0x60, symIndex: 0x0, system: 0x23}, - 42: {compactTag: 0x60, symIndex: 0x0, system: 0x24}, - 43: {compactTag: 0x60, symIndex: 0x0, system: 0x25}, - 44: {compactTag: 0x60, symIndex: 0x0, system: 0x28}, - 45: {compactTag: 0x60, symIndex: 0x0, system: 0x29}, - 46: {compactTag: 0x60, symIndex: 0x0, system: 0x2a}, - 47: {compactTag: 0x60, symIndex: 0x0, system: 0x2b}, - 48: {compactTag: 0x60, symIndex: 0x0, system: 0x2c}, - 49: {compactTag: 0x60, symIndex: 0x0, system: 0x2d}, - 50: {compactTag: 0x60, symIndex: 0x0, system: 0x30}, - 51: {compactTag: 0x60, symIndex: 0x0, system: 0x31}, - 52: {compactTag: 0x60, symIndex: 0x0, system: 0x32}, - 53: {compactTag: 0x60, symIndex: 0x0, system: 0x33}, - 54: {compactTag: 0x60, symIndex: 0x0, system: 0x34}, - 55: {compactTag: 0x60, symIndex: 0x0, system: 0x35}, - 56: {compactTag: 0x60, symIndex: 0x0, system: 0x36}, - 57: {compactTag: 0x60, symIndex: 0x0, system: 0x37}, - 58: {compactTag: 0x60, symIndex: 0x0, system: 0x39}, - 59: {compactTag: 0x60, symIndex: 0x0, system: 0x43}, - 60: {compactTag: 0x64, symIndex: 0x0, system: 0x0}, - 61: {compactTag: 0x64, symIndex: 0x38, system: 0x3}, - 62: {compactTag: 0x64, symIndex: 0x42, system: 0x4}, - 63: {compactTag: 0x7c, symIndex: 0x50, system: 0x37}, - 64: {compactTag: 0x7c, symIndex: 0x0, system: 0x0}, - 65: {compactTag: 0x114, symIndex: 0x43, system: 0x4}, - 66: {compactTag: 0x114, symIndex: 0x18, system: 0x0}, - 67: {compactTag: 0x114, symIndex: 0x3b, system: 0x3}, - 68: {compactTag: 0x123, symIndex: 0x1, system: 0x0}, - 69: {compactTag: 0x123, symIndex: 0x3c, system: 0x3}, - 70: {compactTag: 0x123, symIndex: 0x44, system: 0x4}, - 71: {compactTag: 0x158, symIndex: 0x0, system: 0x0}, - 72: {compactTag: 0x158, symIndex: 0x3b, system: 0x3}, - 73: {compactTag: 0x158, symIndex: 0x45, system: 0x4}, - 74: {compactTag: 0x160, symIndex: 0x0, system: 0x0}, - 75: {compactTag: 0x160, symIndex: 0x38, system: 0x3}, - 76: {compactTag: 0x16d, symIndex: 0x1b, system: 0x0}, - 77: {compactTag: 0x16d, symIndex: 0x0, system: 0x9}, - 78: {compactTag: 0x16d, symIndex: 0x0, system: 0xa}, - 79: {compactTag: 0x17c, symIndex: 0x0, system: 0x0}, - 80: {compactTag: 0x17c, symIndex: 0x3d, system: 0x3}, - 81: {compactTag: 0x17c, symIndex: 0x42, system: 0x4}, - 82: {compactTag: 0x182, symIndex: 0x6, system: 0x0}, - 83: {compactTag: 0x182, symIndex: 0x38, system: 0x3}, - 84: {compactTag: 0x1b1, symIndex: 0x0, system: 0x0}, - 85: {compactTag: 0x1b1, symIndex: 0x3e, system: 0x3}, - 86: {compactTag: 0x1b6, symIndex: 0x42, system: 0x4}, - 87: {compactTag: 0x1b6, symIndex: 0x1b, system: 0x0}, - 88: {compactTag: 0x1d2, symIndex: 0x42, system: 0x4}, - 89: {compactTag: 0x1d2, symIndex: 0x0, system: 0x0}, - 90: {compactTag: 0x1f3, symIndex: 0x0, system: 0xb}, - 91: {compactTag: 0x1fd, symIndex: 0x4e, system: 0x24}, - 92: {compactTag: 0x1fd, symIndex: 0x26, system: 0x0}, - 93: {compactTag: 0x1ff, symIndex: 0x42, system: 0x4}, - 94: {compactTag: 0x204, symIndex: 0x15, system: 0x0}, - 95: {compactTag: 0x204, symIndex: 0x3f, system: 0x3}, - 96: {compactTag: 0x204, symIndex: 0x46, system: 0x4}, - 97: {compactTag: 0x20c, symIndex: 0x0, system: 0xb}, - 98: {compactTag: 0x20f, symIndex: 0x6, system: 0x0}, - 99: {compactTag: 0x20f, symIndex: 0x38, system: 0x3}, - 100: {compactTag: 0x20f, symIndex: 0x42, system: 0x4}, - 101: {compactTag: 0x22e, symIndex: 0x0, system: 0x0}, - 102: {compactTag: 0x22e, symIndex: 0x47, system: 0x4}, - 103: {compactTag: 0x22f, symIndex: 0x42, system: 0x4}, - 104: {compactTag: 0x22f, symIndex: 0x1b, system: 0x0}, - 105: {compactTag: 0x238, symIndex: 0x42, system: 0x4}, - 106: {compactTag: 0x238, symIndex: 0x28, system: 0x0}, - 107: {compactTag: 0x265, symIndex: 0x38, system: 0x3}, - 108: {compactTag: 0x265, symIndex: 0x0, system: 0x0}, - 109: {compactTag: 0x29d, symIndex: 0x22, system: 0x0}, - 110: {compactTag: 0x29d, symIndex: 0x40, system: 0x3}, - 111: {compactTag: 0x29d, symIndex: 0x48, system: 0x4}, - 112: {compactTag: 0x29d, symIndex: 0x4d, system: 0xc}, - 113: {compactTag: 0x2bd, symIndex: 0x31, system: 0x0}, - 114: {compactTag: 0x2bd, symIndex: 0x3e, system: 0x3}, - 115: {compactTag: 0x2bd, symIndex: 0x42, system: 0x4}, - 116: {compactTag: 0x2cd, symIndex: 0x1b, system: 0x0}, - 117: {compactTag: 0x2cd, symIndex: 0x49, system: 0x4}, - 118: {compactTag: 0x2ce, symIndex: 0x49, system: 0x4}, - 119: {compactTag: 0x2d0, symIndex: 0x33, system: 0x0}, - 120: {compactTag: 0x2d0, symIndex: 0x4a, system: 0x4}, - 121: {compactTag: 0x2d1, symIndex: 0x42, system: 0x4}, - 122: {compactTag: 0x2d1, symIndex: 0x28, system: 0x0}, - 123: {compactTag: 0x2d3, symIndex: 0x34, system: 0x0}, - 124: {compactTag: 0x2d3, symIndex: 0x4b, system: 0x4}, - 125: {compactTag: 0x2f9, symIndex: 0x0, system: 0x0}, - 126: {compactTag: 0x2f9, symIndex: 0x38, system: 0x3}, - 127: {compactTag: 0x2f9, symIndex: 0x42, system: 0x4}, - 128: {compactTag: 0x2ff, symIndex: 0x36, system: 0x0}, - 129: {compactTag: 0x2ff, symIndex: 0x41, system: 0x3}, - 130: {compactTag: 0x2ff, symIndex: 0x4c, system: 0x4}, -} // Size: 810 bytes - -var tagToDecimal = []uint8{ // 775 elements - // Entry 0 - 3F - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry 40 - 7F - 0x05, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01, - // Entry 80 - BF - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry C0 - FF - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry 100 - 13F - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry 140 - 17F - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, - 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry 180 - 1BF - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x05, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry 1C0 - 1FF - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, - 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry 200 - 23F - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x05, 0x01, - 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry 240 - 27F - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry 280 - 2BF - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, - 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry 2C0 - 2FF - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, - // Entry 300 - 33F - 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x08, -} // Size: 799 bytes - -var tagToScientific = []uint8{ // 775 elements - // Entry 0 - 3F - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 40 - 7F - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 80 - BF - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry C0 - FF - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 100 - 13F - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 140 - 17F - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c, - 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 180 - 1BF - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 1C0 - 1FF - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 200 - 23F - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c, 0x02, - 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 240 - 27F - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 280 - 2BF - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 2C0 - 2FF - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, - // Entry 300 - 33F - 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x09, -} // Size: 799 bytes - -var tagToPercent = []uint8{ // 775 elements - // Entry 0 - 3F - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - // Entry 40 - 7F - 0x06, 0x06, 0x06, 0x04, 0x04, 0x04, 0x03, 0x03, - 0x06, 0x06, 0x03, 0x04, 0x04, 0x03, 0x03, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x03, - 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, - 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04, 0x03, - 0x03, 0x04, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, - 0x03, 0x04, 0x04, 0x04, 0x07, 0x07, 0x04, 0x04, - // Entry 80 - BF - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x03, 0x04, - 0x04, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - // Entry C0 - FF - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, - 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, - // Entry 100 - 13F - 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, - 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, - 0x0b, 0x0b, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, - 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, - 0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x03, 0x03, - 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, - 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, - // Entry 140 - 17F - 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, - 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, - 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, - 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06, - 0x06, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - // Entry 180 - 1BF - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x06, - 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, - // Entry 1C0 - 1FF - 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - // Entry 200 - 23F - 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x06, 0x04, - 0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - // Entry 240 - 27F - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, - 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, - 0x03, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, - 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, - // Entry 280 - 2BF - 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, - 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06, - 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x0e, - // Entry 2C0 - 2FF - 0x0e, 0x0e, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, - 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, - // Entry 300 - 33F - 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x0a, -} // Size: 799 bytes - -var formats = []Pattern{Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x0, - MinIntegerDigits: 0x0, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x0, - GroupingSize: [2]uint8{0x0, - 0x0}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 3, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x0, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x9, - GroupingSize: [2]uint8{0x3, - 0x0}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x0, - MinIntegerDigits: 0x0, - MaxIntegerDigits: 0x1, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x1}, - Affix: "", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x3, - GroupingSize: [2]uint8{0x0, - 0x0}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x2, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "\x00\x03\u00a0%", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x7, - GroupingSize: [2]uint8{0x3, - 0x0}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x2, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "\x00\x01%", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x6, - GroupingSize: [2]uint8{0x3, - 0x0}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 3, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x0, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0xc, - GroupingSize: [2]uint8{0x3, - 0x2}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x2, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "\x00\x01%", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x9, - GroupingSize: [2]uint8{0x3, - 0x2}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x2, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "\x00\x03\u00a0%", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0xa, - GroupingSize: [2]uint8{0x3, - 0x2}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 6, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x0, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x8, - GroupingSize: [2]uint8{0x0, - 0x0}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 6, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x0, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x6, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x3}, - Affix: "", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0xd, - GroupingSize: [2]uint8{0x0, - 0x0}, - Flags: 0x4}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x2, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "\x00\x01%", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x2, - GroupingSize: [2]uint8{0x0, - 0x0}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x2, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "\x03%\u00a0\x00", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x7, - GroupingSize: [2]uint8{0x3, - 0x0}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x0, - MinIntegerDigits: 0x0, - MaxIntegerDigits: 0x1, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x1}, - Affix: "\x01[\x01]", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x5, - GroupingSize: [2]uint8{0x0, - 0x0}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x0, - MinIntegerDigits: 0x0, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x1, - GroupingSize: [2]uint8{0x0, - 0x0}, - Flags: 0x0}, - Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, - MaxFractionDigits: 0, - Increment: 0x0, - IncrementScale: 0x0, - Mode: 0x0, - DigitShift: 0x2, - MinIntegerDigits: 0x1, - MaxIntegerDigits: 0x0, - MinFractionDigits: 0x0, - MinSignificantDigits: 0x0, - MinExponentDigits: 0x0}, - Affix: "\x01%\x00", - Offset: 0x0, - NegOffset: 0x0, - PadRune: 0, - FormatWidth: 0x6, - GroupingSize: [2]uint8{0x3, - 0x0}, - Flags: 0x0}} - -// Total table size 8634 bytes (8KiB); checksum: 8F23386D diff --git a/vendor/golang.org/x/text/internal/stringset/set.go b/vendor/golang.org/x/text/internal/stringset/set.go deleted file mode 100644 index bb2fffb..0000000 --- a/vendor/golang.org/x/text/internal/stringset/set.go +++ /dev/null @@ -1,86 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package stringset provides a way to represent a collection of strings -// compactly. -package stringset - -import "sort" - -// A Set holds a collection of strings that can be looked up by an index number. -type Set struct { - // These fields are exported to allow for code generation. - - Data string - Index []uint16 -} - -// Elem returns the string with index i. It panics if i is out of range. -func (s *Set) Elem(i int) string { - return s.Data[s.Index[i]:s.Index[i+1]] -} - -// Len returns the number of strings in the set. -func (s *Set) Len() int { - return len(s.Index) - 1 -} - -// Search returns the index of the given string or -1 if it is not in the set. -// The Set must have been created with strings in sorted order. -func Search(s *Set, str string) int { - // TODO: optimize this if it gets used a lot. - n := len(s.Index) - 1 - p := sort.Search(n, func(i int) bool { - return s.Elem(i) >= str - }) - if p == n || str != s.Elem(p) { - return -1 - } - return p -} - -// A Builder constructs Sets. -type Builder struct { - set Set - index map[string]int -} - -// NewBuilder returns a new and initialized Builder. -func NewBuilder() *Builder { - return &Builder{ - set: Set{ - Index: []uint16{0}, - }, - index: map[string]int{}, - } -} - -// Set creates the set created so far. -func (b *Builder) Set() Set { - return b.set -} - -// Index returns the index for the given string, which must have been added -// before. -func (b *Builder) Index(s string) int { - return b.index[s] -} - -// Add adds a string to the index. Strings that are added by a single Add will -// be stored together, unless they match an existing string. -func (b *Builder) Add(ss ...string) { - // First check if the string already exists. - for _, s := range ss { - if _, ok := b.index[s]; ok { - continue - } - b.index[s] = len(b.set.Index) - 1 - b.set.Data += s - x := len(b.set.Data) - if x > 0xFFFF { - panic("Index too > 0xFFFF") - } - b.set.Index = append(b.set.Index, uint16(x)) - } -} diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go deleted file mode 100644 index b5d3488..0000000 --- a/vendor/golang.org/x/text/internal/tag/tag.go +++ /dev/null @@ -1,100 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package tag contains functionality handling tags and related data. -package tag // import "golang.org/x/text/internal/tag" - -import "sort" - -// An Index converts tags to a compact numeric value. -// -// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can -// be used to store additional information about the tag. -type Index string - -// Elem returns the element data at the given index. -func (s Index) Elem(x int) string { - return string(s[x*4 : x*4+4]) -} - -// Index reports the index of the given key or -1 if it could not be found. -// Only the first len(key) bytes from the start of the 4-byte entries will be -// considered for the search and the first match in Index will be returned. -func (s Index) Index(key []byte) int { - n := len(key) - // search the index of the first entry with an equal or higher value than - // key in s. - index := sort.Search(len(s)/4, func(i int) bool { - return cmp(s[i*4:i*4+n], key) != -1 - }) - i := index * 4 - if cmp(s[i:i+len(key)], key) != 0 { - return -1 - } - return index -} - -// Next finds the next occurrence of key after index x, which must have been -// obtained from a call to Index using the same key. It returns x+1 or -1. -func (s Index) Next(key []byte, x int) int { - if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { - return x - } - return -1 -} - -// cmp returns an integer comparing a and b lexicographically. -func cmp(a Index, b []byte) int { - n := len(a) - if len(b) < n { - n = len(b) - } - for i, c := range b[:n] { - switch { - case a[i] > c: - return 1 - case a[i] < c: - return -1 - } - } - switch { - case len(a) < len(b): - return -1 - case len(a) > len(b): - return 1 - } - return 0 -} - -// Compare returns an integer comparing a and b lexicographically. -func Compare(a string, b []byte) int { - return cmp(Index(a), b) -} - -// FixCase reformats b to the same pattern of cases as form. -// If returns false if string b is malformed. -func FixCase(form string, b []byte) bool { - if len(form) != len(b) { - return false - } - for i, c := range b { - if form[i] <= 'Z' { - if c >= 'a' { - c -= 'z' - 'Z' - } - if c < 'A' || 'Z' < c { - return false - } - } else { - if c <= 'Z' { - c += 'z' - 'Z' - } - if c < 'a' || 'z' < c { - return false - } - } - b[i] = c - } - return true -} -- cgit v1.2.3