Genesis commit

author: Thomas Voss <mail@thomasvoss.com> 2024-08-07 00:21:12 +0200
committer: Thomas Voss <mail@thomasvoss.com> 2024-08-07 00:21:12 +0200
commit: 351c15d28e0444fd8a78c510a0c4d62ed433c758 (patch)
tree: b97aae6ec45c1b341075da147fb9e333246c19f7 /vendor/golang.org/x/text/internal
31 files changed, 11765 insertions, 0 deletions
diff --git a/vendor/golang.org/x/text/internal/catmsg/catmsg.go b/vendor/golang.org/x/text/internal/catmsg/catmsg.go
new file mode 100644
index 0000000..1b257a7
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/catmsg/catmsg.go
@@ -0,0 +1,417 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package catmsg contains support types for package x/text/message/catalog.
+//
+// This package contains the low-level implementations of Message used by the
+// catalog package and provides primitives for other packages to implement their
+// own. For instance, the plural package provides functionality for selecting
+// translation strings based on the plural category of substitution arguments.
+//
+// # Encoding and Decoding
+//
+// Catalogs store Messages encoded as a single string. Compiling a message into
+// a string both results in compacter representation and speeds up evaluation.
+//
+// A Message must implement a Compile method to convert its arbitrary
+// representation to a string. The Compile method takes an Encoder which
+// facilitates serializing the message. Encoders also provide more context of
+// the messages's creation (such as for which language the message is intended),
+// which may not be known at the time of the creation of the message.
+//
+// Each message type must also have an accompanying decoder registered to decode
+// the message. This decoder takes a Decoder argument which provides the
+// counterparts for the decoding.
+//
+// # Renderers
+//
+// A Decoder must be initialized with a Renderer implementation. These
+// implementations must be provided by packages that use Catalogs, typically
+// formatting packages such as x/text/message. A typical user will not need to
+// worry about this type; it is only relevant to packages that do string
+// formatting and want to use the catalog package to handle localized strings.
+//
+// A package that uses catalogs for selecting strings receives selection results
+// as sequence of substrings passed to the Renderer. The following snippet shows
+// how to express the above example using the message package.
+//
+//	message.Set(language.English, "You are %d minute(s) late.",
+//		catalog.Var("minutes", plural.Select(1, "one", "minute")),
+//		catalog.String("You are %[1]d ${minutes} late."))
+//
+//	p := message.NewPrinter(language.English)
+//	p.Printf("You are %d minute(s) late.", 5) // always 5 minutes late.
+//
+// To evaluate the Printf, package message wraps the arguments in a Renderer
+// that is passed to the catalog for message decoding. The call sequence that
+// results from evaluating the above message, assuming the person is rather
+// tardy, is:
+//
+//	Render("You are %[1]d ")
+//	Arg(1)
+//	Render("minutes")
+//	Render(" late.")
+//
+// The calls to Arg is caused by the plural.Select execution, which evaluates
+// the argument to determine whether the singular or plural message form should
+// be selected. The calls to Render reports the partial results to the message
+// package for further evaluation.
+package catmsg
+
+import (
+	"errors"
+	"fmt"
+	"strconv"
+	"strings"
+	"sync"
+
+	"golang.org/x/text/language"
+)
+
+// A Handle refers to a registered message type.
+type Handle int
+
+// A Handler decodes and evaluates data compiled by a Message and sends the
+// result to the Decoder. The output may depend on the value of the substitution
+// arguments, accessible by the Decoder's Arg method. The Handler returns false
+// if there is no translation for the given substitution arguments.
+type Handler func(d *Decoder) bool
+
+// Register records the existence of a message type and returns a Handle that
+// can be used in the Encoder's EncodeMessageType method to create such
+// messages. The prefix of the name should be the package path followed by
+// an optional disambiguating string.
+// Register will panic if a handle for the same name was already registered.
+func Register(name string, handler Handler) Handle {
+	mutex.Lock()
+	defer mutex.Unlock()
+
+	if _, ok := names[name]; ok {
+		panic(fmt.Errorf("catmsg: handler for %q already exists", name))
+	}
+	h := Handle(len(handlers))
+	names[name] = h
+	handlers = append(handlers, handler)
+	return h
+}
+
+// These handlers require fixed positions in the handlers slice.
+const (
+	msgVars Handle = iota
+	msgFirst
+	msgRaw
+	msgString
+	msgAffix
+	// Leave some arbitrary room for future expansion: 20 should suffice.
+	numInternal = 20
+)
+
+const prefix = "golang.org/x/text/internal/catmsg."
+
+var (
+	// TODO: find a more stable way to link handles to message types.
+	mutex sync.Mutex
+	names = map[string]Handle{
+		prefix + "Vars":   msgVars,
+		prefix + "First":  msgFirst,
+		prefix + "Raw":    msgRaw,
+		prefix + "String": msgString,
+		prefix + "Affix":  msgAffix,
+	}
+	handlers = make([]Handler, numInternal)
+)
+
+func init() {
+	// This handler is a message type wrapper that initializes a decoder
+	// with a variable block. This message type, if present, is always at the
+	// start of an encoded message.
+	handlers[msgVars] = func(d *Decoder) bool {
+		blockSize := int(d.DecodeUint())
+		d.vars = d.data[:blockSize]
+		d.data = d.data[blockSize:]
+		return d.executeMessage()
+	}
+
+	// First takes the first message in a sequence that results in a match for
+	// the given substitution arguments.
+	handlers[msgFirst] = func(d *Decoder) bool {
+		for !d.Done() {
+			if d.ExecuteMessage() {
+				return true
+			}
+		}
+		return false
+	}
+
+	handlers[msgRaw] = func(d *Decoder) bool {
+		d.Render(d.data)
+		return true
+	}
+
+	// A String message alternates between a string constant and a variable
+	// substitution.
+	handlers[msgString] = func(d *Decoder) bool {
+		for !d.Done() {
+			if str := d.DecodeString(); str != "" {
+				d.Render(str)
+			}
+			if d.Done() {
+				break
+			}
+			d.ExecuteSubstitution()
+		}
+		return true
+	}
+
+	handlers[msgAffix] = func(d *Decoder) bool {
+		// TODO: use an alternative method for common cases.
+		prefix := d.DecodeString()
+		suffix := d.DecodeString()
+		if prefix != "" {
+			d.Render(prefix)
+		}
+		ret := d.ExecuteMessage()
+		if suffix != "" {
+			d.Render(suffix)
+		}
+		return ret
+	}
+}
+
+var (
+	// ErrIncomplete indicates a compiled message does not define translations
+	// for all possible argument values. If this message is returned, evaluating
+	// a message may result in the ErrNoMatch error.
+	ErrIncomplete = errors.New("catmsg: incomplete message; may not give result for all inputs")
+
+	// ErrNoMatch indicates no translation message matched the given input
+	// parameters when evaluating a message.
+	ErrNoMatch = errors.New("catmsg: no translation for inputs")
+)
+
+// A Message holds a collection of translations for the same phrase that may
+// vary based on the values of substitution arguments.
+type Message interface {
+	// Compile encodes the format string(s) of the message as a string for later
+	// evaluation.
+	//
+	// The first call Compile makes on the encoder must be EncodeMessageType.
+	// The handle passed to this call may either be a handle returned by
+	// Register to encode a single custom message, or HandleFirst followed by
+	// a sequence of calls to EncodeMessage.
+	//
+	// Compile must return ErrIncomplete if it is possible for evaluation to
+	// not match any translation for a given set of formatting parameters.
+	// For example, selecting a translation based on plural form may not yield
+	// a match if the form "Other" is not one of the selectors.
+	//
+	// Compile may return any other application-specific error. For backwards
+	// compatibility with package like fmt, which often do not do sanity
+	// checking of format strings ahead of time, Compile should still make an
+	// effort to have some sensible fallback in case of an error.
+	Compile(e *Encoder) error
+}
+
+// Compile converts a Message to a data string that can be stored in a Catalog.
+// The resulting string can subsequently be decoded by passing to the Execute
+// method of a Decoder.
+func Compile(tag language.Tag, macros Dictionary, m Message) (data string, err error) {
+	// TODO: pass macros so they can be used for validation.
+	v := &Encoder{inBody: true} // encoder for variables
+	v.root = v
+	e := &Encoder{root: v, parent: v, tag: tag} // encoder for messages
+	err = m.Compile(e)
+	// This package serves te message package, which in turn is meant to be a
+	// drop-in replacement for fmt.  With the fmt package, format strings are
+	// evaluated lazily and errors are handled by substituting strings in the
+	// result, rather then returning an error. Dealing with multiple languages
+	// makes it more important to check errors ahead of time. We chose to be
+	// consistent and compatible and allow graceful degradation in case of
+	// errors.
+	buf := e.buf[stripPrefix(e.buf):]
+	if len(v.buf) > 0 {
+		// Prepend variable block.
+		b := make([]byte, 1+maxVarintBytes+len(v.buf)+len(buf))
+		b[0] = byte(msgVars)
+		b = b[:1+encodeUint(b[1:], uint64(len(v.buf)))]
+		b = append(b, v.buf...)
+		b = append(b, buf...)
+		buf = b
+	}
+	if err == nil {
+		err = v.err
+	}
+	return string(buf), err
+}
+
+// FirstOf is a message type that prints the first message in the sequence that
+// resolves to a match for the given substitution arguments.
+type FirstOf []Message
+
+// Compile implements Message.
+func (s FirstOf) Compile(e *Encoder) error {
+	e.EncodeMessageType(msgFirst)
+	err := ErrIncomplete
+	for i, m := range s {
+		if err == nil {
+			return fmt.Errorf("catalog: message argument %d is complete and blocks subsequent messages", i-1)
+		}
+		err = e.EncodeMessage(m)
+	}
+	return err
+}
+
+// Var defines a message that can be substituted for a placeholder of the same
+// name. If an expression does not result in a string after evaluation, Name is
+// used as the substitution. For example:
+//
+//	Var{
+//	  Name:    "minutes",
+//	  Message: plural.Select(1, "one", "minute"),
+//	}
+//
+// will resolve to minute for singular and minutes for plural forms.
+type Var struct {
+	Name    string
+	Message Message
+}
+
+var errIsVar = errors.New("catmsg: variable used as message")
+
+// Compile implements Message.
+//
+// Note that this method merely registers a variable; it does not create an
+// encoded message.
+func (v *Var) Compile(e *Encoder) error {
+	if err := e.addVar(v.Name, v.Message); err != nil {
+		return err
+	}
+	// Using a Var by itself is an error. If it is in a sequence followed by
+	// other messages referring to it, this error will be ignored.
+	return errIsVar
+}
+
+// Raw is a message consisting of a single format string that is passed as is
+// to the Renderer.
+//
+// Note that a Renderer may still do its own variable substitution.
+type Raw string
+
+// Compile implements Message.
+func (r Raw) Compile(e *Encoder) (err error) {
+	e.EncodeMessageType(msgRaw)
+	// Special case: raw strings don't have a size encoding and so don't use
+	// EncodeString.
+	e.buf = append(e.buf, r...)
+	return nil
+}
+
+// String is a message consisting of a single format string which contains
+// placeholders that may be substituted with variables.
+//
+// Variable substitutions are marked with placeholders and a variable name of
+// the form ${name}. Any other substitutions such as Go templates or
+// printf-style substitutions are left to be done by the Renderer.
+//
+// When evaluation a string interpolation, a Renderer will receive separate
+// calls for each placeholder and interstitial string. For example, for the
+// message: "%[1]v ${invites} %[2]v to ${their} party." The sequence of calls
+// is:
+//
+//	d.Render("%[1]v ")
+//	d.Arg(1)
+//	d.Render(resultOfInvites)
+//	d.Render(" %[2]v to ")
+//	d.Arg(2)
+//	d.Render(resultOfTheir)
+//	d.Render(" party.")
+//
+// where the messages for "invites" and "their" both use a plural.Select
+// referring to the first argument.
+//
+// Strings may also invoke macros. Macros are essentially variables that can be
+// reused. Macros may, for instance, be used to make selections between
+// different conjugations of a verb. See the catalog package description for an
+// overview of macros.
+type String string
+
+// Compile implements Message. It parses the placeholder formats and returns
+// any error.
+func (s String) Compile(e *Encoder) (err error) {
+	msg := string(s)
+	const subStart = "${"
+	hasHeader := false
+	p := 0
+	b := []byte{}
+	for {
+		i := strings.Index(msg[p:], subStart)
+		if i == -1 {
+			break
+		}
+		b = append(b, msg[p:p+i]...)
+		p += i + len(subStart)
+		if i = strings.IndexByte(msg[p:], '}'); i == -1 {
+			b = append(b, "$!(MISSINGBRACE)"...)
+			err = fmt.Errorf("catmsg: missing '}'")
+			p = len(msg)
+			break
+		}
+		name := strings.TrimSpace(msg[p : p+i])
+		if q := strings.IndexByte(name, '('); q == -1 {
+			if !hasHeader {
+				hasHeader = true
+				e.EncodeMessageType(msgString)
+			}
+			e.EncodeString(string(b))
+			e.EncodeSubstitution(name)
+			b = b[:0]
+		} else if j := strings.IndexByte(name[q:], ')'); j == -1 {
+			// TODO: what should the error be?
+			b = append(b, "$!(MISSINGPAREN)"...)
+			err = fmt.Errorf("catmsg: missing ')'")
+		} else if x, sErr := strconv.ParseUint(strings.TrimSpace(name[q+1:q+j]), 10, 32); sErr != nil {
+			// TODO: handle more than one argument
+			b = append(b, "$!(BADNUM)"...)
+			err = fmt.Errorf("catmsg: invalid number %q", strings.TrimSpace(name[q+1:q+j]))
+		} else {
+			if !hasHeader {
+				hasHeader = true
+				e.EncodeMessageType(msgString)
+			}
+			e.EncodeString(string(b))
+			e.EncodeSubstitution(name[:q], int(x))
+			b = b[:0]
+		}
+		p += i + 1
+	}
+	b = append(b, msg[p:]...)
+	if !hasHeader {
+		// Simplify string to a raw string.
+		Raw(string(b)).Compile(e)
+	} else if len(b) > 0 {
+		e.EncodeString(string(b))
+	}
+	return err
+}
+
+// Affix is a message that adds a prefix and suffix to another message.
+// This is mostly used add back whitespace to a translation that was stripped
+// before sending it out.
+type Affix struct {
+	Message Message
+	Prefix  string
+	Suffix  string
+}
+
+// Compile implements Message.
+func (a Affix) Compile(e *Encoder) (err error) {
+	// TODO: consider adding a special message type that just adds a single
+	// return. This is probably common enough to handle the majority of cases.
+	// Get some stats first, though.
+	e.EncodeMessageType(msgAffix)
+	e.EncodeString(a.Prefix)
+	e.EncodeString(a.Suffix)
+	e.EncodeMessage(a.Message)
+	return nil
+}
diff --git a/vendor/golang.org/x/text/internal/catmsg/codec.go b/vendor/golang.org/x/text/internal/catmsg/codec.go
new file mode 100644
index 0000000..49c9fc9
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/catmsg/codec.go
@@ -0,0 +1,407 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package catmsg
+
+import (
+	"errors"
+	"fmt"
+
+	"golang.org/x/text/language"
+)
+
+// A Renderer renders a Message.
+type Renderer interface {
+	// Render renders the given string. The given string may be interpreted as a
+	// format string, such as the one used by the fmt package or a template.
+	Render(s string)
+
+	// Arg returns the i-th argument passed to format a message. This method
+	// should return nil if there is no such argument. Messages need access to
+	// arguments to allow selecting a message based on linguistic features of
+	// those arguments.
+	Arg(i int) interface{}
+}
+
+// A Dictionary specifies a source of messages, including variables or macros.
+type Dictionary interface {
+	// Lookup returns the message for the given key. It returns false for ok if
+	// such a message could not be found.
+	Lookup(key string) (data string, ok bool)
+
+	// TODO: consider returning an interface, instead of a string. This will
+	// allow implementations to do their own message type decoding.
+}
+
+// An Encoder serializes a Message to a string.
+type Encoder struct {
+	// The root encoder is used for storing encoded variables.
+	root *Encoder
+	// The parent encoder provides the surrounding scopes for resolving variable
+	// names.
+	parent *Encoder
+
+	tag language.Tag
+
+	// buf holds the encoded message so far. After a message completes encoding,
+	// the contents of buf, prefixed by the encoded length, are flushed to the
+	// parent buffer.
+	buf []byte
+
+	// vars is the lookup table of variables in the current scope.
+	vars []keyVal
+
+	err    error
+	inBody bool // if false next call must be EncodeMessageType
+}
+
+type keyVal struct {
+	key    string
+	offset int
+}
+
+// Language reports the language for which the encoded message will be stored
+// in the Catalog.
+func (e *Encoder) Language() language.Tag { return e.tag }
+
+func (e *Encoder) setError(err error) {
+	if e.root.err == nil {
+		e.root.err = err
+	}
+}
+
+// EncodeUint encodes x.
+func (e *Encoder) EncodeUint(x uint64) {
+	e.checkInBody()
+	var buf [maxVarintBytes]byte
+	n := encodeUint(buf[:], x)
+	e.buf = append(e.buf, buf[:n]...)
+}
+
+// EncodeString encodes s.
+func (e *Encoder) EncodeString(s string) {
+	e.checkInBody()
+	e.EncodeUint(uint64(len(s)))
+	e.buf = append(e.buf, s...)
+}
+
+// EncodeMessageType marks the current message to be of type h.
+//
+// It must be the first call of a Message's Compile method.
+func (e *Encoder) EncodeMessageType(h Handle) {
+	if e.inBody {
+		panic("catmsg: EncodeMessageType not the first method called")
+	}
+	e.inBody = true
+	e.EncodeUint(uint64(h))
+}
+
+// EncodeMessage serializes the given message inline at the current position.
+func (e *Encoder) EncodeMessage(m Message) error {
+	e = &Encoder{root: e.root, parent: e, tag: e.tag}
+	err := m.Compile(e)
+	if _, ok := m.(*Var); !ok {
+		e.flushTo(e.parent)
+	}
+	return err
+}
+
+func (e *Encoder) checkInBody() {
+	if !e.inBody {
+		panic("catmsg: expected prior call to EncodeMessageType")
+	}
+}
+
+// stripPrefix indicates the number of prefix bytes that must be stripped to
+// turn a single-element sequence into a message that is just this single member
+// without its size prefix. If the message can be stripped, b[1:n] contains the
+// size prefix.
+func stripPrefix(b []byte) (n int) {
+	if len(b) > 0 && Handle(b[0]) == msgFirst {
+		x, n, _ := decodeUint(b[1:])
+		if 1+n+int(x) == len(b) {
+			return 1 + n
+		}
+	}
+	return 0
+}
+
+func (e *Encoder) flushTo(dst *Encoder) {
+	data := e.buf
+	p := stripPrefix(data)
+	if p > 0 {
+		data = data[1:]
+	} else {
+		// Prefix the size.
+		dst.EncodeUint(uint64(len(data)))
+	}
+	dst.buf = append(dst.buf, data...)
+}
+
+func (e *Encoder) addVar(key string, m Message) error {
+	for _, v := range e.parent.vars {
+		if v.key == key {
+			err := fmt.Errorf("catmsg: duplicate variable %q", key)
+			e.setError(err)
+			return err
+		}
+	}
+	scope := e.parent
+	// If a variable message is Incomplete, and does not evaluate to a message
+	// during execution, we fall back to the variable name. We encode this by
+	// appending the variable name if the message reports it's incomplete.
+
+	err := m.Compile(e)
+	if err != ErrIncomplete {
+		e.setError(err)
+	}
+	switch {
+	case len(e.buf) == 1 && Handle(e.buf[0]) == msgFirst: // empty sequence
+		e.buf = e.buf[:0]
+		e.inBody = false
+		fallthrough
+	case len(e.buf) == 0:
+		// Empty message.
+		if err := String(key).Compile(e); err != nil {
+			e.setError(err)
+		}
+	case err == ErrIncomplete:
+		if Handle(e.buf[0]) != msgFirst {
+			seq := &Encoder{root: e.root, parent: e}
+			seq.EncodeMessageType(msgFirst)
+			e.flushTo(seq)
+			e = seq
+		}
+		// e contains a sequence; append the fallback string.
+		e.EncodeMessage(String(key))
+	}
+
+	// Flush result to variable heap.
+	offset := len(e.root.buf)
+	e.flushTo(e.root)
+	e.buf = e.buf[:0]
+
+	// Record variable offset in current scope.
+	scope.vars = append(scope.vars, keyVal{key: key, offset: offset})
+	return err
+}
+
+const (
+	substituteVar = iota
+	substituteMacro
+	substituteError
+)
+
+// EncodeSubstitution inserts a resolved reference to a variable or macro.
+//
+// This call must be matched with a call to ExecuteSubstitution at decoding
+// time.
+func (e *Encoder) EncodeSubstitution(name string, arguments ...int) {
+	if arity := len(arguments); arity > 0 {
+		// TODO: also resolve macros.
+		e.EncodeUint(substituteMacro)
+		e.EncodeString(name)
+		for _, a := range arguments {
+			e.EncodeUint(uint64(a))
+		}
+		return
+	}
+	for scope := e; scope != nil; scope = scope.parent {
+		for _, v := range scope.vars {
+			if v.key != name {
+				continue
+			}
+			e.EncodeUint(substituteVar) // TODO: support arity > 0
+			e.EncodeUint(uint64(v.offset))
+			return
+		}
+	}
+	// TODO: refer to dictionary-wide scoped variables.
+	e.EncodeUint(substituteError)
+	e.EncodeString(name)
+	e.setError(fmt.Errorf("catmsg: unknown var %q", name))
+}
+
+// A Decoder deserializes and evaluates messages that are encoded by an encoder.
+type Decoder struct {
+	tag    language.Tag
+	dst    Renderer
+	macros Dictionary
+
+	err  error
+	vars string
+	data string
+
+	macroArg int // TODO: allow more than one argument
+}
+
+// NewDecoder returns a new Decoder.
+//
+// Decoders are designed to be reused for multiple invocations of Execute.
+// Only one goroutine may call Execute concurrently.
+func NewDecoder(tag language.Tag, r Renderer, macros Dictionary) *Decoder {
+	return &Decoder{
+		tag:    tag,
+		dst:    r,
+		macros: macros,
+	}
+}
+
+func (d *Decoder) setError(err error) {
+	if d.err == nil {
+		d.err = err
+	}
+}
+
+// Language returns the language in which the message is being rendered.
+//
+// The destination language may be a child language of the language used for
+// encoding. For instance, a decoding language of "pt-PT"" is consistent with an
+// encoding language of "pt".
+func (d *Decoder) Language() language.Tag { return d.tag }
+
+// Done reports whether there are more bytes to process in this message.
+func (d *Decoder) Done() bool { return len(d.data) == 0 }
+
+// Render implements Renderer.
+func (d *Decoder) Render(s string) { d.dst.Render(s) }
+
+// Arg implements Renderer.
+//
+// During evaluation of macros, the argument positions may be mapped to
+// arguments that differ from the original call.
+func (d *Decoder) Arg(i int) interface{} {
+	if d.macroArg != 0 {
+		if i != 1 {
+			panic("catmsg: only macros with single argument supported")
+		}
+		i = d.macroArg
+	}
+	return d.dst.Arg(i)
+}
+
+// DecodeUint decodes a number that was encoded with EncodeUint and advances the
+// position.
+func (d *Decoder) DecodeUint() uint64 {
+	x, n, err := decodeUintString(d.data)
+	d.data = d.data[n:]
+	if err != nil {
+		d.setError(err)
+	}
+	return x
+}
+
+// DecodeString decodes a string that was encoded with EncodeString and advances
+// the position.
+func (d *Decoder) DecodeString() string {
+	size := d.DecodeUint()
+	s := d.data[:size]
+	d.data = d.data[size:]
+	return s
+}
+
+// SkipMessage skips the message at the current location and advances the
+// position.
+func (d *Decoder) SkipMessage() {
+	n := int(d.DecodeUint())
+	d.data = d.data[n:]
+}
+
+// Execute decodes and evaluates msg.
+//
+// Only one goroutine may call execute.
+func (d *Decoder) Execute(msg string) error {
+	d.err = nil
+	if !d.execute(msg) {
+		return ErrNoMatch
+	}
+	return d.err
+}
+
+func (d *Decoder) execute(msg string) bool {
+	saved := d.data
+	d.data = msg
+	ok := d.executeMessage()
+	d.data = saved
+	return ok
+}
+
+// executeMessageFromData is like execute, but also decodes a leading message
+// size and clips the given string accordingly.
+//
+// It reports the number of bytes consumed and whether a message was selected.
+func (d *Decoder) executeMessageFromData(s string) (n int, ok bool) {
+	saved := d.data
+	d.data = s
+	size := int(d.DecodeUint())
+	n = len(s) - len(d.data)
+	// Sanitize the setting. This allows skipping a size argument for
+	// RawString and method Done.
+	d.data = d.data[:size]
+	ok = d.executeMessage()
+	n += size - len(d.data)
+	d.data = saved
+	return n, ok
+}
+
+var errUnknownHandler = errors.New("catmsg: string contains unsupported handler")
+
+// executeMessage reads the handle id, initializes the decoder and executes the
+// message. It is assumed that all of d.data[d.p:] is the single message.
+func (d *Decoder) executeMessage() bool {
+	if d.Done() {
+		// We interpret no data as a valid empty message.
+		return true
+	}
+	handle := d.DecodeUint()
+
+	var fn Handler
+	mutex.Lock()
+	if int(handle) < len(handlers) {
+		fn = handlers[handle]
+	}
+	mutex.Unlock()
+	if fn == nil {
+		d.setError(errUnknownHandler)
+		d.execute(fmt.Sprintf("\x02$!(UNKNOWNMSGHANDLER=%#x)", handle))
+		return true
+	}
+	return fn(d)
+}
+
+// ExecuteMessage decodes and executes the message at the current position.
+func (d *Decoder) ExecuteMessage() bool {
+	n, ok := d.executeMessageFromData(d.data)
+	d.data = d.data[n:]
+	return ok
+}
+
+// ExecuteSubstitution executes the message corresponding to the substitution
+// as encoded by EncodeSubstitution.
+func (d *Decoder) ExecuteSubstitution() {
+	switch x := d.DecodeUint(); x {
+	case substituteVar:
+		offset := d.DecodeUint()
+		d.executeMessageFromData(d.vars[offset:])
+	case substituteMacro:
+		name := d.DecodeString()
+		data, ok := d.macros.Lookup(name)
+		old := d.macroArg
+		// TODO: support macros of arity other than 1.
+		d.macroArg = int(d.DecodeUint())
+		switch {
+		case !ok:
+			// TODO: detect this at creation time.
+			d.setError(fmt.Errorf("catmsg: undefined macro %q", name))
+			fallthrough
+		case !d.execute(data):
+			d.dst.Render(name) // fall back to macro name.
+		}
+		d.macroArg = old
+	case substituteError:
+		d.dst.Render(d.DecodeString())
+	default:
+		panic("catmsg: unreachable")
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/catmsg/varint.go b/vendor/golang.org/x/text/internal/catmsg/varint.go
new file mode 100644
index 0000000..a2cee2c
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/catmsg/varint.go
@@ -0,0 +1,62 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package catmsg
+
+// This file implements varint encoding analogous to the one in encoding/binary.
+// We need a string version of this function, so we add that here and then add
+// the rest for consistency.
+
+import "errors"
+
+var (
+	errIllegalVarint  = errors.New("catmsg: illegal varint")
+	errVarintTooLarge = errors.New("catmsg: varint too large for uint64")
+)
+
+const maxVarintBytes = 10 // maximum length of a varint
+
+// encodeUint encodes x as a variable-sized integer into buf and returns the
+// number of bytes written. buf must be at least maxVarintBytes long
+func encodeUint(buf []byte, x uint64) (n int) {
+	for ; x > 127; n++ {
+		buf[n] = 0x80 | uint8(x&0x7F)
+		x >>= 7
+	}
+	buf[n] = uint8(x)
+	n++
+	return n
+}
+
+func decodeUintString(s string) (x uint64, size int, err error) {
+	i := 0
+	for shift := uint(0); shift < 64; shift += 7 {
+		if i >= len(s) {
+			return 0, i, errIllegalVarint
+		}
+		b := uint64(s[i])
+		i++
+		x |= (b & 0x7F) << shift
+		if b&0x80 == 0 {
+			return x, i, nil
+		}
+	}
+	return 0, i, errVarintTooLarge
+}
+
+func decodeUint(b []byte) (x uint64, size int, err error) {
+	i := 0
+	for shift := uint(0); shift < 64; shift += 7 {
+		if i >= len(b) {
+			return 0, i, errIllegalVarint
+		}
+		c := uint64(b[i])
+		i++
+		x |= (c & 0x7F) << shift
+		if c&0x80 == 0 {
+			return x, i, nil
+		}
+	}
+	return 0, i, errVarintTooLarge
+}
diff --git a/vendor/golang.org/x/text/internal/format/format.go b/vendor/golang.org/x/text/internal/format/format.go
new file mode 100644
index 0000000..ee1c57a
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/format/format.go
@@ -0,0 +1,41 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package format contains types for defining language-specific formatting of
+// values.
+//
+// This package is internal now, but will eventually be exposed after the API
+// settles.
+package format // import "golang.org/x/text/internal/format"
+
+import (
+	"fmt"
+
+	"golang.org/x/text/language"
+)
+
+// State represents the printer state passed to custom formatters. It provides
+// access to the fmt.State interface and the sentence and language-related
+// context.
+type State interface {
+	fmt.State
+
+	// Language reports the requested language in which to render a message.
+	Language() language.Tag
+
+	// TODO: consider this and removing rune from the Format method in the
+	// Formatter interface.
+	//
+	// Verb returns the format variant to render, analogous to the types used
+	// in fmt. Use 'v' for the default or only variant.
+	// Verb() rune
+
+	// TODO: more info:
+	// - sentence context such as linguistic features passed by the translator.
+}
+
+// Formatter is analogous to fmt.Formatter.
+type Formatter interface {
+	Format(state State, verb rune)
+}
diff --git a/vendor/golang.org/x/text/internal/format/parser.go b/vendor/golang.org/x/text/internal/format/parser.go
new file mode 100644
index 0000000..855aed7
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/format/parser.go
@@ -0,0 +1,358 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package format
+
+import (
+	"reflect"
+	"unicode/utf8"
+)
+
+// A Parser parses a format string. The result from the parse are set in the
+// struct fields.
+type Parser struct {
+	Verb rune
+
+	WidthPresent bool
+	PrecPresent  bool
+	Minus        bool
+	Plus         bool
+	Sharp        bool
+	Space        bool
+	Zero         bool
+
+	// For the formats %+v %#v, we set the plusV/sharpV flags
+	// and clear the plus/sharp flags since %+v and %#v are in effect
+	// different, flagless formats set at the top level.
+	PlusV  bool
+	SharpV bool
+
+	HasIndex bool
+
+	Width int
+	Prec  int // precision
+
+	// retain arguments across calls.
+	Args []interface{}
+	// retain current argument number across calls
+	ArgNum int
+
+	// reordered records whether the format string used argument reordering.
+	Reordered bool
+	// goodArgNum records whether the most recent reordering directive was valid.
+	goodArgNum bool
+
+	// position info
+	format   string
+	startPos int
+	endPos   int
+	Status   Status
+}
+
+// Reset initializes a parser to scan format strings for the given args.
+func (p *Parser) Reset(args []interface{}) {
+	p.Args = args
+	p.ArgNum = 0
+	p.startPos = 0
+	p.Reordered = false
+}
+
+// Text returns the part of the format string that was parsed by the last call
+// to Scan. It returns the original substitution clause if the current scan
+// parsed a substitution.
+func (p *Parser) Text() string { return p.format[p.startPos:p.endPos] }
+
+// SetFormat sets a new format string to parse. It does not reset the argument
+// count.
+func (p *Parser) SetFormat(format string) {
+	p.format = format
+	p.startPos = 0
+	p.endPos = 0
+}
+
+// Status indicates the result type of a call to Scan.
+type Status int
+
+const (
+	StatusText Status = iota
+	StatusSubstitution
+	StatusBadWidthSubstitution
+	StatusBadPrecSubstitution
+	StatusNoVerb
+	StatusBadArgNum
+	StatusMissingArg
+)
+
+// ClearFlags reset the parser to default behavior.
+func (p *Parser) ClearFlags() {
+	p.WidthPresent = false
+	p.PrecPresent = false
+	p.Minus = false
+	p.Plus = false
+	p.Sharp = false
+	p.Space = false
+	p.Zero = false
+
+	p.PlusV = false
+	p.SharpV = false
+
+	p.HasIndex = false
+}
+
+// Scan scans the next part of the format string and sets the status to
+// indicate whether it scanned a string literal, substitution or error.
+func (p *Parser) Scan() bool {
+	p.Status = StatusText
+	format := p.format
+	end := len(format)
+	if p.endPos >= end {
+		return false
+	}
+	afterIndex := false // previous item in format was an index like [3].
+
+	p.startPos = p.endPos
+	p.goodArgNum = true
+	i := p.startPos
+	for i < end && format[i] != '%' {
+		i++
+	}
+	if i > p.startPos {
+		p.endPos = i
+		return true
+	}
+	// Process one verb
+	i++
+
+	p.Status = StatusSubstitution
+
+	// Do we have flags?
+	p.ClearFlags()
+
+simpleFormat:
+	for ; i < end; i++ {
+		c := p.format[i]
+		switch c {
+		case '#':
+			p.Sharp = true
+		case '0':
+			p.Zero = !p.Minus // Only allow zero padding to the left.
+		case '+':
+			p.Plus = true
+		case '-':
+			p.Minus = true
+			p.Zero = false // Do not pad with zeros to the right.
+		case ' ':
+			p.Space = true
+		default:
+			// Fast path for common case of ascii lower case simple verbs
+			// without precision or width or argument indices.
+			if 'a' <= c && c <= 'z' && p.ArgNum < len(p.Args) {
+				if c == 'v' {
+					// Go syntax
+					p.SharpV = p.Sharp
+					p.Sharp = false
+					// Struct-field syntax
+					p.PlusV = p.Plus
+					p.Plus = false
+				}
+				p.Verb = rune(c)
+				p.ArgNum++
+				p.endPos = i + 1
+				return true
+			}
+			// Format is more complex than simple flags and a verb or is malformed.
+			break simpleFormat
+		}
+	}
+
+	// Do we have an explicit argument index?
+	i, afterIndex = p.updateArgNumber(format, i)
+
+	// Do we have width?
+	if i < end && format[i] == '*' {
+		i++
+		p.Width, p.WidthPresent = p.intFromArg()
+
+		if !p.WidthPresent {
+			p.Status = StatusBadWidthSubstitution
+		}
+
+		// We have a negative width, so take its value and ensure
+		// that the minus flag is set
+		if p.Width < 0 {
+			p.Width = -p.Width
+			p.Minus = true
+			p.Zero = false // Do not pad with zeros to the right.
+		}
+		afterIndex = false
+	} else {
+		p.Width, p.WidthPresent, i = parsenum(format, i, end)
+		if afterIndex && p.WidthPresent { // "%[3]2d"
+			p.goodArgNum = false
+		}
+	}
+
+	// Do we have precision?
+	if i+1 < end && format[i] == '.' {
+		i++
+		if afterIndex { // "%[3].2d"
+			p.goodArgNum = false
+		}
+		i, afterIndex = p.updateArgNumber(format, i)
+		if i < end && format[i] == '*' {
+			i++
+			p.Prec, p.PrecPresent = p.intFromArg()
+			// Negative precision arguments don't make sense
+			if p.Prec < 0 {
+				p.Prec = 0
+				p.PrecPresent = false
+			}
+			if !p.PrecPresent {
+				p.Status = StatusBadPrecSubstitution
+			}
+			afterIndex = false
+		} else {
+			p.Prec, p.PrecPresent, i = parsenum(format, i, end)
+			if !p.PrecPresent {
+				p.Prec = 0
+				p.PrecPresent = true
+			}
+		}
+	}
+
+	if !afterIndex {
+		i, afterIndex = p.updateArgNumber(format, i)
+	}
+	p.HasIndex = afterIndex
+
+	if i >= end {
+		p.endPos = i
+		p.Status = StatusNoVerb
+		return true
+	}
+
+	verb, w := utf8.DecodeRuneInString(format[i:])
+	p.endPos = i + w
+	p.Verb = verb
+
+	switch {
+	case verb == '%': // Percent does not absorb operands and ignores f.wid and f.prec.
+		p.startPos = p.endPos - 1
+		p.Status = StatusText
+	case !p.goodArgNum:
+		p.Status = StatusBadArgNum
+	case p.ArgNum >= len(p.Args): // No argument left over to print for the current verb.
+		p.Status = StatusMissingArg
+		p.ArgNum++
+	case verb == 'v':
+		// Go syntax
+		p.SharpV = p.Sharp
+		p.Sharp = false
+		// Struct-field syntax
+		p.PlusV = p.Plus
+		p.Plus = false
+		fallthrough
+	default:
+		p.ArgNum++
+	}
+	return true
+}
+
+// intFromArg gets the ArgNumth element of Args. On return, isInt reports
+// whether the argument has integer type.
+func (p *Parser) intFromArg() (num int, isInt bool) {
+	if p.ArgNum < len(p.Args) {
+		arg := p.Args[p.ArgNum]
+		num, isInt = arg.(int) // Almost always OK.
+		if !isInt {
+			// Work harder.
+			switch v := reflect.ValueOf(arg); v.Kind() {
+			case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
+				n := v.Int()
+				if int64(int(n)) == n {
+					num = int(n)
+					isInt = true
+				}
+			case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr:
+				n := v.Uint()
+				if int64(n) >= 0 && uint64(int(n)) == n {
+					num = int(n)
+					isInt = true
+				}
+			default:
+				// Already 0, false.
+			}
+		}
+		p.ArgNum++
+		if tooLarge(num) {
+			num = 0
+			isInt = false
+		}
+	}
+	return
+}
+
+// parseArgNumber returns the value of the bracketed number, minus 1
+// (explicit argument numbers are one-indexed but we want zero-indexed).
+// The opening bracket is known to be present at format[0].
+// The returned values are the index, the number of bytes to consume
+// up to the closing paren, if present, and whether the number parsed
+// ok. The bytes to consume will be 1 if no closing paren is present.
+func parseArgNumber(format string) (index int, wid int, ok bool) {
+	// There must be at least 3 bytes: [n].
+	if len(format) < 3 {
+		return 0, 1, false
+	}
+
+	// Find closing bracket.
+	for i := 1; i < len(format); i++ {
+		if format[i] == ']' {
+			width, ok, newi := parsenum(format, 1, i)
+			if !ok || newi != i {
+				return 0, i + 1, false
+			}
+			return width - 1, i + 1, true // arg numbers are one-indexed and skip paren.
+		}
+	}
+	return 0, 1, false
+}
+
+// updateArgNumber returns the next argument to evaluate, which is either the value of the passed-in
+// argNum or the value of the bracketed integer that begins format[i:]. It also returns
+// the new value of i, that is, the index of the next byte of the format to process.
+func (p *Parser) updateArgNumber(format string, i int) (newi int, found bool) {
+	if len(format) <= i || format[i] != '[' {
+		return i, false
+	}
+	p.Reordered = true
+	index, wid, ok := parseArgNumber(format[i:])
+	if ok && 0 <= index && index < len(p.Args) {
+		p.ArgNum = index
+		return i + wid, true
+	}
+	p.goodArgNum = false
+	return i + wid, ok
+}
+
+// tooLarge reports whether the magnitude of the integer is
+// too large to be used as a formatting width or precision.
+func tooLarge(x int) bool {
+	const max int = 1e6
+	return x > max || x < -max
+}
+
+// parsenum converts ASCII to integer.  num is 0 (and isnum is false) if no number present.
+func parsenum(s string, start, end int) (num int, isnum bool, newi int) {
+	if start >= end {
+		return 0, false, end
+	}
+	for newi = start; newi < end && '0' <= s[newi] && s[newi] <= '9'; newi++ {
+		if tooLarge(num) {
+			return 0, false, end // Overflow; crazy long number most likely.
+		}
+		num = num*10 + int(s[newi]-'0')
+		isnum = true
+	}
+	return
+}
diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go
new file mode 100644
index 0000000..3cddbbd
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/internal.go
@@ -0,0 +1,49 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package internal contains non-exported functionality that are used by
+// packages in the text repository.
+package internal // import "golang.org/x/text/internal"
+
+import (
+	"sort"
+
+	"golang.org/x/text/language"
+)
+
+// SortTags sorts tags in place.
+func SortTags(tags []language.Tag) {
+	sort.Sort(sorter(tags))
+}
+
+type sorter []language.Tag
+
+func (s sorter) Len() int {
+	return len(s)
+}
+
+func (s sorter) Swap(i, j int) {
+	s[i], s[j] = s[j], s[i]
+}
+
+func (s sorter) Less(i, j int) bool {
+	return s[i].String() < s[j].String()
+}
+
+// UniqueTags sorts and filters duplicate tags in place and returns a slice with
+// only unique tags.
+func UniqueTags(tags []language.Tag) []language.Tag {
+	if len(tags) <= 1 {
+		return tags
+	}
+	SortTags(tags)
+	k := 0
+	for i := 1; i < len(tags); i++ {
+		if tags[k].String() < tags[i].String() {
+			k++
+			tags[k] = tags[i]
+		}
+	}
+	return tags[:k+1]
+}
diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
new file mode 100644
index 0000000..cdfdb74
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/common.go
@@ -0,0 +1,16 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// This file contains code common to the maketables.go and the package code.
+
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
+
+const (
+	Deprecated AliasType = iota
+	Macro
+	Legacy
+
+	AliasTypeUnknown AliasType = -1
+)
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
new file mode 100644
index 0000000..46a0015
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact.go
@@ -0,0 +1,29 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// CompactCoreInfo is a compact integer with the three core tags encoded.
+type CompactCoreInfo uint32
+
+// GetCompactCore generates a uint32 value that is guaranteed to be unique for
+// different language, region, and script values.
+func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
+	if t.LangID > langNoIndexOffset {
+		return 0, false
+	}
+	cci |= CompactCoreInfo(t.LangID) << (8 + 12)
+	cci |= CompactCoreInfo(t.ScriptID) << 12
+	cci |= CompactCoreInfo(t.RegionID)
+	return cci, true
+}
+
+// Tag generates a tag from c.
+func (c CompactCoreInfo) Tag() Tag {
+	return Tag{
+		LangID:   Language(c >> 20),
+		RegionID: Region(c & 0x3ff),
+		ScriptID: Script(c>>12) & 0xff,
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
new file mode 100644
index 0000000..1b36935
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/compact.go
@@ -0,0 +1,61 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package compact defines a compact representation of language tags.
+//
+// Common language tags (at least all for which locale information is defined
+// in CLDR) are assigned a unique index. Each Tag is associated with such an
+// ID for selecting language-related resources (such as translations) as well
+// as one for selecting regional defaults (currency, number formatting, etc.)
+//
+// It may want to export this functionality at some point, but at this point
+// this is only available for use within x/text.
+package compact // import "golang.org/x/text/internal/language/compact"
+
+import (
+	"sort"
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// ID is an integer identifying a single tag.
+type ID uint16
+
+func getCoreIndex(t language.Tag) (id ID, ok bool) {
+	cci, ok := language.GetCompactCore(t)
+	if !ok {
+		return 0, false
+	}
+	i := sort.Search(len(coreTags), func(i int) bool {
+		return cci <= coreTags[i]
+	})
+	if i == len(coreTags) || coreTags[i] != cci {
+		return 0, false
+	}
+	return ID(i), true
+}
+
+// Parent returns the ID of the parent or the root ID if id is already the root.
+func (id ID) Parent() ID {
+	return parents[id]
+}
+
+// Tag converts id to an internal language Tag.
+func (id ID) Tag() language.Tag {
+	if int(id) >= len(coreTags) {
+		return specialTags[int(id)-len(coreTags)]
+	}
+	return coreTags[id].Tag()
+}
+
+var specialTags []language.Tag
+
+func init() {
+	tags := strings.Split(specialTagsStr, " ")
+	specialTags = make([]language.Tag, len(tags))
+	for i, t := range tags {
+		specialTags[i] = language.MustParse(t)
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
new file mode 100644
index 0000000..8c1b666
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/language.go
@@ -0,0 +1,260 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_index.go -output tables.go
+//go:generate go run gen_parents.go
+
+package compact
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+	// NOTE: exported tags will become part of the public API.
+	language ID
+	locale   ID
+	full     fullTag // always a language.Tag for now.
+}
+
+const _und = 0
+
+type fullTag interface {
+	IsRoot() bool
+	Parent() language.Tag
+}
+
+// Make a compact Tag from a fully specified internal language Tag.
+func Make(t language.Tag) (tag Tag) {
+	if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
+		if r, err := language.ParseRegion(region[:2]); err == nil {
+			tFull := t
+			t, _ = t.SetTypeForKey("rg", "")
+			// TODO: should we not consider "va" for the language tag?
+			var exact1, exact2 bool
+			tag.language, exact1 = FromTag(t)
+			t.RegionID = r
+			tag.locale, exact2 = FromTag(t)
+			if !exact1 || !exact2 {
+				tag.full = tFull
+			}
+			return tag
+		}
+	}
+	lang, ok := FromTag(t)
+	tag.language = lang
+	tag.locale = lang
+	if !ok {
+		tag.full = t
+	}
+	return tag
+}
+
+// Tag returns an internal language Tag version of this tag.
+func (t Tag) Tag() language.Tag {
+	if t.full != nil {
+		return t.full.(language.Tag)
+	}
+	tag := t.language.Tag()
+	if t.language != t.locale {
+		loc := t.locale.Tag()
+		tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
+	}
+	return tag
+}
+
+// IsCompact reports whether this tag is fully defined in terms of ID.
+func (t *Tag) IsCompact() bool {
+	return t.full == nil
+}
+
+// MayHaveVariants reports whether a tag may have variants. If it returns false
+// it is guaranteed the tag does not have variants.
+func (t Tag) MayHaveVariants() bool {
+	return t.full != nil || int(t.language) >= len(coreTags)
+}
+
+// MayHaveExtensions reports whether a tag may have extensions. If it returns
+// false it is guaranteed the tag does not have them.
+func (t Tag) MayHaveExtensions() bool {
+	return t.full != nil ||
+		int(t.language) >= len(coreTags) ||
+		t.language != t.locale
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+	if t.full != nil {
+		return t.full.IsRoot()
+	}
+	return t.language == _und
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+	if t.full != nil {
+		return Make(t.full.Parent())
+	}
+	if t.language != t.locale {
+		// Simulate stripping -u-rg-xxxxxx
+		return Tag{language: t.language, locale: t.language}
+	}
+	// TODO: use parent lookup table once cycle from internal package is
+	// removed. Probably by internalizing the table and declaring this fast
+	// enough.
+	// lang := compactID(internal.Parent(uint16(t.language)))
+	lang, _ := FromTag(t.language.Tag().Parent())
+	return Tag{language: lang, locale: lang}
+}
+
+// nextToken returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+	p := strings.Index(s[1:], "-")
+	if p == -1 {
+		return s[1:], ""
+	}
+	p++
+	return s[1:p], s[p:]
+}
+
+// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func LanguageID(t Tag) (id ID, exact bool) {
+	return t.language, t.full == nil
+}
+
+// RegionalID returns the ID for the regional variant of this tag. This index is
+// used to indicate region-specific overrides, such as default currency, default
+// calendar and week data, default time cycle, and default measurement system
+// and unit preferences.
+//
+// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
+// settings for currency, number formatting, etc. The CompactIndex for this tag
+// will be that for en-GB, while the RegionalID will be the one corresponding to
+// en-US.
+func RegionalID(t Tag) (id ID, exact bool) {
+	return t.locale, t.full == nil
+}
+
+// LanguageTag returns t stripped of regional variant indicators.
+//
+// At the moment this means it is stripped of a regional and variant subtag "rg"
+// and "va" in the "u" extension.
+func (t Tag) LanguageTag() Tag {
+	if t.full == nil {
+		return Tag{language: t.language, locale: t.language}
+	}
+	tt := t.Tag()
+	tt.SetTypeForKey("rg", "")
+	tt.SetTypeForKey("va", "")
+	return Make(tt)
+}
+
+// RegionalTag returns the regional variant of the tag.
+//
+// At the moment this means that the region is set from the regional subtag
+// "rg" in the "u" extension.
+func (t Tag) RegionalTag() Tag {
+	rt := Tag{language: t.locale, locale: t.locale}
+	if t.full == nil {
+		return rt
+	}
+	b := language.Builder{}
+	tag := t.Tag()
+	// tag, _ = tag.SetTypeForKey("rg", "")
+	b.SetTag(t.locale.Tag())
+	if v := tag.Variants(); v != "" {
+		for _, v := range strings.Split(v, "-") {
+			b.AddVariant(v)
+		}
+	}
+	for _, e := range tag.Extensions() {
+		b.AddExt(e)
+	}
+	return t
+}
+
+// FromTag reports closest matching ID for an internal language Tag.
+func FromTag(t language.Tag) (id ID, exact bool) {
+	// TODO: perhaps give more frequent tags a lower index.
+	// TODO: we could make the indexes stable. This will excluded some
+	//       possibilities for optimization, so don't do this quite yet.
+	exact = true
+
+	b, s, r := t.Raw()
+	if t.HasString() {
+		if t.IsPrivateUse() {
+			// We have no entries for user-defined tags.
+			return 0, false
+		}
+		hasExtra := false
+		if t.HasVariants() {
+			if t.HasExtensions() {
+				build := language.Builder{}
+				build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
+				build.AddVariant(t.Variants())
+				exact = false
+				t = build.Make()
+			}
+			hasExtra = true
+		} else if _, ok := t.Extension('u'); ok {
+			// TODO: va may mean something else. Consider not considering it.
+			// Strip all but the 'va' entry.
+			old := t
+			variant := t.TypeForKey("va")
+			t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
+			if variant != "" {
+				t, _ = t.SetTypeForKey("va", variant)
+				hasExtra = true
+			}
+			exact = old == t
+		} else {
+			exact = false
+		}
+		if hasExtra {
+			// We have some variants.
+			for i, s := range specialTags {
+				if s == t {
+					return ID(i + len(coreTags)), exact
+				}
+			}
+			exact = false
+		}
+	}
+	if x, ok := getCoreIndex(t); ok {
+		return x, exact
+	}
+	exact = false
+	if r != 0 && s == 0 {
+		// Deal with cases where an extra script is inserted for the region.
+		t, _ := t.Maximize()
+		if x, ok := getCoreIndex(t); ok {
+			return x, exact
+		}
+	}
+	for t = t.Parent(); t != root; t = t.Parent() {
+		// No variants specified: just compare core components.
+		// The key has the form lllssrrr, where l, s, and r are nibbles for
+		// respectively the langID, scriptID, and regionID.
+		if x, ok := getCoreIndex(t); ok {
+			return x, exact
+		}
+	}
+	return 0, exact
+}
+
+var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
new file mode 100644
index 0000000..8d81072
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/parents.go
@@ -0,0 +1,120 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+// parents maps a compact index of a tag to the compact index of the parent of
+// this tag.
+var parents = []ID{ // 775 elements
+	// Entry 0 - 3F
+	0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
+	0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
+	0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
+	0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
+	0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
+	// Entry 40 - 7F
+	0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
+	0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
+	0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
+	0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
+	0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
+	0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
+	0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
+	0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
+	// Entry 80 - BF
+	0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
+	0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
+	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
+	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
+	// Entry C0 - FF
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
+	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
+	0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
+	0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
+	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
+	// Entry 100 - 13F
+	0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
+	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
+	0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
+	0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
+	0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	// Entry 140 - 17F
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
+	0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
+	0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
+	0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
+	0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
+	0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
+	// Entry 180 - 1BF
+	0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
+	0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
+	0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
+	0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
+	0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
+	0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
+	0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
+	0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
+	// Entry 1C0 - 1FF
+	0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
+	0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
+	0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
+	0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
+	0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
+	0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
+	0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
+	0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
+	// Entry 200 - 23F
+	0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
+	0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
+	0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
+	0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
+	0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
+	0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
+	0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
+	// Entry 240 - 27F
+	0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
+	0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
+	0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
+	0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
+	0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
+	0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
+	0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
+	0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
+	// Entry 280 - 2BF
+	0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
+	0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
+	0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
+	0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
+	0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
+	0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
+	0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
+	0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
+	// Entry 2C0 - 2FF
+	0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
+	0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
+	0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
+	0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
+	0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
+	0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
+	0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
+	0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
+	// Entry 300 - 33F
+	0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
+} // Size: 1574 bytes
+
+// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
new file mode 100644
index 0000000..a09ed19
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -0,0 +1,1015 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+import "golang.org/x/text/internal/language"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 775
+const (
+	undIndex          ID = 0
+	afIndex           ID = 1
+	afNAIndex         ID = 2
+	afZAIndex         ID = 3
+	agqIndex          ID = 4
+	agqCMIndex        ID = 5
+	akIndex           ID = 6
+	akGHIndex         ID = 7
+	amIndex           ID = 8
+	amETIndex         ID = 9
+	arIndex           ID = 10
+	ar001Index        ID = 11
+	arAEIndex         ID = 12
+	arBHIndex         ID = 13
+	arDJIndex         ID = 14
+	arDZIndex         ID = 15
+	arEGIndex         ID = 16
+	arEHIndex         ID = 17
+	arERIndex         ID = 18
+	arILIndex         ID = 19
+	arIQIndex         ID = 20
+	arJOIndex         ID = 21
+	arKMIndex         ID = 22
+	arKWIndex         ID = 23
+	arLBIndex         ID = 24
+	arLYIndex         ID = 25
+	arMAIndex         ID = 26
+	arMRIndex         ID = 27
+	arOMIndex         ID = 28
+	arPSIndex         ID = 29
+	arQAIndex         ID = 30
+	arSAIndex         ID = 31
+	arSDIndex         ID = 32
+	arSOIndex         ID = 33
+	arSSIndex         ID = 34
+	arSYIndex         ID = 35
+	arTDIndex         ID = 36
+	arTNIndex         ID = 37
+	arYEIndex         ID = 38
+	arsIndex          ID = 39
+	asIndex           ID = 40
+	asINIndex         ID = 41
+	asaIndex          ID = 42
+	asaTZIndex        ID = 43
+	astIndex          ID = 44
+	astESIndex        ID = 45
+	azIndex           ID = 46
+	azCyrlIndex       ID = 47
+	azCyrlAZIndex     ID = 48
+	azLatnIndex       ID = 49
+	azLatnAZIndex     ID = 50
+	basIndex          ID = 51
+	basCMIndex        ID = 52
+	beIndex           ID = 53
+	beBYIndex         ID = 54
+	bemIndex          ID = 55
+	bemZMIndex        ID = 56
+	bezIndex          ID = 57
+	bezTZIndex        ID = 58
+	bgIndex           ID = 59
+	bgBGIndex         ID = 60
+	bhIndex           ID = 61
+	bmIndex           ID = 62
+	bmMLIndex         ID = 63
+	bnIndex           ID = 64
+	bnBDIndex         ID = 65
+	bnINIndex         ID = 66
+	boIndex           ID = 67
+	boCNIndex         ID = 68
+	boINIndex         ID = 69
+	brIndex           ID = 70
+	brFRIndex         ID = 71
+	brxIndex          ID = 72
+	brxINIndex        ID = 73
+	bsIndex           ID = 74
+	bsCyrlIndex       ID = 75
+	bsCyrlBAIndex     ID = 76
+	bsLatnIndex       ID = 77
+	bsLatnBAIndex     ID = 78
+	caIndex           ID = 79
+	caADIndex         ID = 80
+	caESIndex         ID = 81
+	caFRIndex         ID = 82
+	caITIndex         ID = 83
+	ccpIndex          ID = 84
+	ccpBDIndex        ID = 85
+	ccpINIndex        ID = 86
+	ceIndex           ID = 87
+	ceRUIndex         ID = 88
+	cggIndex          ID = 89
+	cggUGIndex        ID = 90
+	chrIndex          ID = 91
+	chrUSIndex        ID = 92
+	ckbIndex          ID = 93
+	ckbIQIndex        ID = 94
+	ckbIRIndex        ID = 95
+	csIndex           ID = 96
+	csCZIndex         ID = 97
+	cuIndex           ID = 98
+	cuRUIndex         ID = 99
+	cyIndex           ID = 100
+	cyGBIndex         ID = 101
+	daIndex           ID = 102
+	daDKIndex         ID = 103
+	daGLIndex         ID = 104
+	davIndex          ID = 105
+	davKEIndex        ID = 106
+	deIndex           ID = 107
+	deATIndex         ID = 108
+	deBEIndex         ID = 109
+	deCHIndex         ID = 110
+	deDEIndex         ID = 111
+	deITIndex         ID = 112
+	deLIIndex         ID = 113
+	deLUIndex         ID = 114
+	djeIndex          ID = 115
+	djeNEIndex        ID = 116
+	dsbIndex          ID = 117
+	dsbDEIndex        ID = 118
+	duaIndex          ID = 119
+	duaCMIndex        ID = 120
+	dvIndex           ID = 121
+	dyoIndex          ID = 122
+	dyoSNIndex        ID = 123
+	dzIndex           ID = 124
+	dzBTIndex         ID = 125
+	ebuIndex          ID = 126
+	ebuKEIndex        ID = 127
+	eeIndex           ID = 128
+	eeGHIndex         ID = 129
+	eeTGIndex         ID = 130
+	elIndex           ID = 131
+	elCYIndex         ID = 132
+	elGRIndex         ID = 133
+	enIndex           ID = 134
+	en001Index        ID = 135
+	en150Index        ID = 136
+	enAGIndex         ID = 137
+	enAIIndex         ID = 138
+	enASIndex         ID = 139
+	enATIndex         ID = 140
+	enAUIndex         ID = 141
+	enBBIndex         ID = 142
+	enBEIndex         ID = 143
+	enBIIndex         ID = 144
+	enBMIndex         ID = 145
+	enBSIndex         ID = 146
+	enBWIndex         ID = 147
+	enBZIndex         ID = 148
+	enCAIndex         ID = 149
+	enCCIndex         ID = 150
+	enCHIndex         ID = 151
+	enCKIndex         ID = 152
+	enCMIndex         ID = 153
+	enCXIndex         ID = 154
+	enCYIndex         ID = 155
+	enDEIndex         ID = 156
+	enDGIndex         ID = 157
+	enDKIndex         ID = 158
+	enDMIndex         ID = 159
+	enERIndex         ID = 160
+	enFIIndex         ID = 161
+	enFJIndex         ID = 162
+	enFKIndex         ID = 163
+	enFMIndex         ID = 164
+	enGBIndex         ID = 165
+	enGDIndex         ID = 166
+	enGGIndex         ID = 167
+	enGHIndex         ID = 168
+	enGIIndex         ID = 169
+	enGMIndex         ID = 170
+	enGUIndex         ID = 171
+	enGYIndex         ID = 172
+	enHKIndex         ID = 173
+	enIEIndex         ID = 174
+	enILIndex         ID = 175
+	enIMIndex         ID = 176
+	enINIndex         ID = 177
+	enIOIndex         ID = 178
+	enJEIndex         ID = 179
+	enJMIndex         ID = 180
+	enKEIndex         ID = 181
+	enKIIndex         ID = 182
+	enKNIndex         ID = 183
+	enKYIndex         ID = 184
+	enLCIndex         ID = 185
+	enLRIndex         ID = 186
+	enLSIndex         ID = 187
+	enMGIndex         ID = 188
+	enMHIndex         ID = 189
+	enMOIndex         ID = 190
+	enMPIndex         ID = 191
+	enMSIndex         ID = 192
+	enMTIndex         ID = 193
+	enMUIndex         ID = 194
+	enMWIndex         ID = 195
+	enMYIndex         ID = 196
+	enNAIndex         ID = 197
+	enNFIndex         ID = 198
+	enNGIndex         ID = 199
+	enNLIndex         ID = 200
+	enNRIndex         ID = 201
+	enNUIndex         ID = 202
+	enNZIndex         ID = 203
+	enPGIndex         ID = 204
+	enPHIndex         ID = 205
+	enPKIndex         ID = 206
+	enPNIndex         ID = 207
+	enPRIndex         ID = 208
+	enPWIndex         ID = 209
+	enRWIndex         ID = 210
+	enSBIndex         ID = 211
+	enSCIndex         ID = 212
+	enSDIndex         ID = 213
+	enSEIndex         ID = 214
+	enSGIndex         ID = 215
+	enSHIndex         ID = 216
+	enSIIndex         ID = 217
+	enSLIndex         ID = 218
+	enSSIndex         ID = 219
+	enSXIndex         ID = 220
+	enSZIndex         ID = 221
+	enTCIndex         ID = 222
+	enTKIndex         ID = 223
+	enTOIndex         ID = 224
+	enTTIndex         ID = 225
+	enTVIndex         ID = 226
+	enTZIndex         ID = 227
+	enUGIndex         ID = 228
+	enUMIndex         ID = 229
+	enUSIndex         ID = 230
+	enVCIndex         ID = 231
+	enVGIndex         ID = 232
+	enVIIndex         ID = 233
+	enVUIndex         ID = 234
+	enWSIndex         ID = 235
+	enZAIndex         ID = 236
+	enZMIndex         ID = 237
+	enZWIndex         ID = 238
+	eoIndex           ID = 239
+	eo001Index        ID = 240
+	esIndex           ID = 241
+	es419Index        ID = 242
+	esARIndex         ID = 243
+	esBOIndex         ID = 244
+	esBRIndex         ID = 245
+	esBZIndex         ID = 246
+	esCLIndex         ID = 247
+	esCOIndex         ID = 248
+	esCRIndex         ID = 249
+	esCUIndex         ID = 250
+	esDOIndex         ID = 251
+	esEAIndex         ID = 252
+	esECIndex         ID = 253
+	esESIndex         ID = 254
+	esGQIndex         ID = 255
+	esGTIndex         ID = 256
+	esHNIndex         ID = 257
+	esICIndex         ID = 258
+	esMXIndex         ID = 259
+	esNIIndex         ID = 260
+	esPAIndex         ID = 261
+	esPEIndex         ID = 262
+	esPHIndex         ID = 263
+	esPRIndex         ID = 264
+	esPYIndex         ID = 265
+	esSVIndex         ID = 266
+	esUSIndex         ID = 267
+	esUYIndex         ID = 268
+	esVEIndex         ID = 269
+	etIndex           ID = 270
+	etEEIndex         ID = 271
+	euIndex           ID = 272
+	euESIndex         ID = 273
+	ewoIndex          ID = 274
+	ewoCMIndex        ID = 275
+	faIndex           ID = 276
+	faAFIndex         ID = 277
+	faIRIndex         ID = 278
+	ffIndex           ID = 279
+	ffCMIndex         ID = 280
+	ffGNIndex         ID = 281
+	ffMRIndex         ID = 282
+	ffSNIndex         ID = 283
+	fiIndex           ID = 284
+	fiFIIndex         ID = 285
+	filIndex          ID = 286
+	filPHIndex        ID = 287
+	foIndex           ID = 288
+	foDKIndex         ID = 289
+	foFOIndex         ID = 290
+	frIndex           ID = 291
+	frBEIndex         ID = 292
+	frBFIndex         ID = 293
+	frBIIndex         ID = 294
+	frBJIndex         ID = 295
+	frBLIndex         ID = 296
+	frCAIndex         ID = 297
+	frCDIndex         ID = 298
+	frCFIndex         ID = 299
+	frCGIndex         ID = 300
+	frCHIndex         ID = 301
+	frCIIndex         ID = 302
+	frCMIndex         ID = 303
+	frDJIndex         ID = 304
+	frDZIndex         ID = 305
+	frFRIndex         ID = 306
+	frGAIndex         ID = 307
+	frGFIndex         ID = 308
+	frGNIndex         ID = 309
+	frGPIndex         ID = 310
+	frGQIndex         ID = 311
+	frHTIndex         ID = 312
+	frKMIndex         ID = 313
+	frLUIndex         ID = 314
+	frMAIndex         ID = 315
+	frMCIndex         ID = 316
+	frMFIndex         ID = 317
+	frMGIndex         ID = 318
+	frMLIndex         ID = 319
+	frMQIndex         ID = 320
+	frMRIndex         ID = 321
+	frMUIndex         ID = 322
+	frNCIndex         ID = 323
+	frNEIndex         ID = 324
+	frPFIndex         ID = 325
+	frPMIndex         ID = 326
+	frREIndex         ID = 327
+	frRWIndex         ID = 328
+	frSCIndex         ID = 329
+	frSNIndex         ID = 330
+	frSYIndex         ID = 331
+	frTDIndex         ID = 332
+	frTGIndex         ID = 333
+	frTNIndex         ID = 334
+	frVUIndex         ID = 335
+	frWFIndex         ID = 336
+	frYTIndex         ID = 337
+	furIndex          ID = 338
+	furITIndex        ID = 339
+	fyIndex           ID = 340
+	fyNLIndex         ID = 341
+	gaIndex           ID = 342
+	gaIEIndex         ID = 343
+	gdIndex           ID = 344
+	gdGBIndex         ID = 345
+	glIndex           ID = 346
+	glESIndex         ID = 347
+	gswIndex          ID = 348
+	gswCHIndex        ID = 349
+	gswFRIndex        ID = 350
+	gswLIIndex        ID = 351
+	guIndex           ID = 352
+	guINIndex         ID = 353
+	guwIndex          ID = 354
+	guzIndex          ID = 355
+	guzKEIndex        ID = 356
+	gvIndex           ID = 357
+	gvIMIndex         ID = 358
+	haIndex           ID = 359
+	haGHIndex         ID = 360
+	haNEIndex         ID = 361
+	haNGIndex         ID = 362
+	hawIndex          ID = 363
+	hawUSIndex        ID = 364
+	heIndex           ID = 365
+	heILIndex         ID = 366
+	hiIndex           ID = 367
+	hiINIndex         ID = 368
+	hrIndex           ID = 369
+	hrBAIndex         ID = 370
+	hrHRIndex         ID = 371
+	hsbIndex          ID = 372
+	hsbDEIndex        ID = 373
+	huIndex           ID = 374
+	huHUIndex         ID = 375
+	hyIndex           ID = 376
+	hyAMIndex         ID = 377
+	idIndex           ID = 378
+	idIDIndex         ID = 379
+	igIndex           ID = 380
+	igNGIndex         ID = 381
+	iiIndex           ID = 382
+	iiCNIndex         ID = 383
+	inIndex           ID = 384
+	ioIndex           ID = 385
+	isIndex           ID = 386
+	isISIndex         ID = 387
+	itIndex           ID = 388
+	itCHIndex         ID = 389
+	itITIndex         ID = 390
+	itSMIndex         ID = 391
+	itVAIndex         ID = 392
+	iuIndex           ID = 393
+	iwIndex           ID = 394
+	jaIndex           ID = 395
+	jaJPIndex         ID = 396
+	jboIndex          ID = 397
+	jgoIndex          ID = 398
+	jgoCMIndex        ID = 399
+	jiIndex           ID = 400
+	jmcIndex          ID = 401
+	jmcTZIndex        ID = 402
+	jvIndex           ID = 403
+	jwIndex           ID = 404
+	kaIndex           ID = 405
+	kaGEIndex         ID = 406
+	kabIndex          ID = 407
+	kabDZIndex        ID = 408
+	kajIndex          ID = 409
+	kamIndex          ID = 410
+	kamKEIndex        ID = 411
+	kcgIndex          ID = 412
+	kdeIndex          ID = 413
+	kdeTZIndex        ID = 414
+	keaIndex          ID = 415
+	keaCVIndex        ID = 416
+	khqIndex          ID = 417
+	khqMLIndex        ID = 418
+	kiIndex           ID = 419
+	kiKEIndex         ID = 420
+	kkIndex           ID = 421
+	kkKZIndex         ID = 422
+	kkjIndex          ID = 423
+	kkjCMIndex        ID = 424
+	klIndex           ID = 425
+	klGLIndex         ID = 426
+	klnIndex          ID = 427
+	klnKEIndex        ID = 428
+	kmIndex           ID = 429
+	kmKHIndex         ID = 430
+	knIndex           ID = 431
+	knINIndex         ID = 432
+	koIndex           ID = 433
+	koKPIndex         ID = 434
+	koKRIndex         ID = 435
+	kokIndex          ID = 436
+	kokINIndex        ID = 437
+	ksIndex           ID = 438
+	ksINIndex         ID = 439
+	ksbIndex          ID = 440
+	ksbTZIndex        ID = 441
+	ksfIndex          ID = 442
+	ksfCMIndex        ID = 443
+	kshIndex          ID = 444
+	kshDEIndex        ID = 445
+	kuIndex           ID = 446
+	kwIndex           ID = 447
+	kwGBIndex         ID = 448
+	kyIndex           ID = 449
+	kyKGIndex         ID = 450
+	lagIndex          ID = 451
+	lagTZIndex        ID = 452
+	lbIndex           ID = 453
+	lbLUIndex         ID = 454
+	lgIndex           ID = 455
+	lgUGIndex         ID = 456
+	lktIndex          ID = 457
+	lktUSIndex        ID = 458
+	lnIndex           ID = 459
+	lnAOIndex         ID = 460
+	lnCDIndex         ID = 461
+	lnCFIndex         ID = 462
+	lnCGIndex         ID = 463
+	loIndex           ID = 464
+	loLAIndex         ID = 465
+	lrcIndex          ID = 466
+	lrcIQIndex        ID = 467
+	lrcIRIndex        ID = 468
+	ltIndex           ID = 469
+	ltLTIndex         ID = 470
+	luIndex           ID = 471
+	luCDIndex         ID = 472
+	luoIndex          ID = 473
+	luoKEIndex        ID = 474
+	luyIndex          ID = 475
+	luyKEIndex        ID = 476
+	lvIndex           ID = 477
+	lvLVIndex         ID = 478
+	masIndex          ID = 479
+	masKEIndex        ID = 480
+	masTZIndex        ID = 481
+	merIndex          ID = 482
+	merKEIndex        ID = 483
+	mfeIndex          ID = 484
+	mfeMUIndex        ID = 485
+	mgIndex           ID = 486
+	mgMGIndex         ID = 487
+	mghIndex          ID = 488
+	mghMZIndex        ID = 489
+	mgoIndex          ID = 490
+	mgoCMIndex        ID = 491
+	mkIndex           ID = 492
+	mkMKIndex         ID = 493
+	mlIndex           ID = 494
+	mlINIndex         ID = 495
+	mnIndex           ID = 496
+	mnMNIndex         ID = 497
+	moIndex           ID = 498
+	mrIndex           ID = 499
+	mrINIndex         ID = 500
+	msIndex           ID = 501
+	msBNIndex         ID = 502
+	msMYIndex         ID = 503
+	msSGIndex         ID = 504
+	mtIndex           ID = 505
+	mtMTIndex         ID = 506
+	muaIndex          ID = 507
+	muaCMIndex        ID = 508
+	myIndex           ID = 509
+	myMMIndex         ID = 510
+	mznIndex          ID = 511
+	mznIRIndex        ID = 512
+	nahIndex          ID = 513
+	naqIndex          ID = 514
+	naqNAIndex        ID = 515
+	nbIndex           ID = 516
+	nbNOIndex         ID = 517
+	nbSJIndex         ID = 518
+	ndIndex           ID = 519
+	ndZWIndex         ID = 520
+	ndsIndex          ID = 521
+	ndsDEIndex        ID = 522
+	ndsNLIndex        ID = 523
+	neIndex           ID = 524
+	neINIndex         ID = 525
+	neNPIndex         ID = 526
+	nlIndex           ID = 527
+	nlAWIndex         ID = 528
+	nlBEIndex         ID = 529
+	nlBQIndex         ID = 530
+	nlCWIndex         ID = 531
+	nlNLIndex         ID = 532
+	nlSRIndex         ID = 533
+	nlSXIndex         ID = 534
+	nmgIndex          ID = 535
+	nmgCMIndex        ID = 536
+	nnIndex           ID = 537
+	nnNOIndex         ID = 538
+	nnhIndex          ID = 539
+	nnhCMIndex        ID = 540
+	noIndex           ID = 541
+	nqoIndex          ID = 542
+	nrIndex           ID = 543
+	nsoIndex          ID = 544
+	nusIndex          ID = 545
+	nusSSIndex        ID = 546
+	nyIndex           ID = 547
+	nynIndex          ID = 548
+	nynUGIndex        ID = 549
+	omIndex           ID = 550
+	omETIndex         ID = 551
+	omKEIndex         ID = 552
+	orIndex           ID = 553
+	orINIndex         ID = 554
+	osIndex           ID = 555
+	osGEIndex         ID = 556
+	osRUIndex         ID = 557
+	paIndex           ID = 558
+	paArabIndex       ID = 559
+	paArabPKIndex     ID = 560
+	paGuruIndex       ID = 561
+	paGuruINIndex     ID = 562
+	papIndex          ID = 563
+	plIndex           ID = 564
+	plPLIndex         ID = 565
+	prgIndex          ID = 566
+	prg001Index       ID = 567
+	psIndex           ID = 568
+	psAFIndex         ID = 569
+	ptIndex           ID = 570
+	ptAOIndex         ID = 571
+	ptBRIndex         ID = 572
+	ptCHIndex         ID = 573
+	ptCVIndex         ID = 574
+	ptGQIndex         ID = 575
+	ptGWIndex         ID = 576
+	ptLUIndex         ID = 577
+	ptMOIndex         ID = 578
+	ptMZIndex         ID = 579
+	ptPTIndex         ID = 580
+	ptSTIndex         ID = 581
+	ptTLIndex         ID = 582
+	quIndex           ID = 583
+	quBOIndex         ID = 584
+	quECIndex         ID = 585
+	quPEIndex         ID = 586
+	rmIndex           ID = 587
+	rmCHIndex         ID = 588
+	rnIndex           ID = 589
+	rnBIIndex         ID = 590
+	roIndex           ID = 591
+	roMDIndex         ID = 592
+	roROIndex         ID = 593
+	rofIndex          ID = 594
+	rofTZIndex        ID = 595
+	ruIndex           ID = 596
+	ruBYIndex         ID = 597
+	ruKGIndex         ID = 598
+	ruKZIndex         ID = 599
+	ruMDIndex         ID = 600
+	ruRUIndex         ID = 601
+	ruUAIndex         ID = 602
+	rwIndex           ID = 603
+	rwRWIndex         ID = 604
+	rwkIndex          ID = 605
+	rwkTZIndex        ID = 606
+	sahIndex          ID = 607
+	sahRUIndex        ID = 608
+	saqIndex          ID = 609
+	saqKEIndex        ID = 610
+	sbpIndex          ID = 611
+	sbpTZIndex        ID = 612
+	sdIndex           ID = 613
+	sdPKIndex         ID = 614
+	sdhIndex          ID = 615
+	seIndex           ID = 616
+	seFIIndex         ID = 617
+	seNOIndex         ID = 618
+	seSEIndex         ID = 619
+	sehIndex          ID = 620
+	sehMZIndex        ID = 621
+	sesIndex          ID = 622
+	sesMLIndex        ID = 623
+	sgIndex           ID = 624
+	sgCFIndex         ID = 625
+	shIndex           ID = 626
+	shiIndex          ID = 627
+	shiLatnIndex      ID = 628
+	shiLatnMAIndex    ID = 629
+	shiTfngIndex      ID = 630
+	shiTfngMAIndex    ID = 631
+	siIndex           ID = 632
+	siLKIndex         ID = 633
+	skIndex           ID = 634
+	skSKIndex         ID = 635
+	slIndex           ID = 636
+	slSIIndex         ID = 637
+	smaIndex          ID = 638
+	smiIndex          ID = 639
+	smjIndex          ID = 640
+	smnIndex          ID = 641
+	smnFIIndex        ID = 642
+	smsIndex          ID = 643
+	snIndex           ID = 644
+	snZWIndex         ID = 645
+	soIndex           ID = 646
+	soDJIndex         ID = 647
+	soETIndex         ID = 648
+	soKEIndex         ID = 649
+	soSOIndex         ID = 650
+	sqIndex           ID = 651
+	sqALIndex         ID = 652
+	sqMKIndex         ID = 653
+	sqXKIndex         ID = 654
+	srIndex           ID = 655
+	srCyrlIndex       ID = 656
+	srCyrlBAIndex     ID = 657
+	srCyrlMEIndex     ID = 658
+	srCyrlRSIndex     ID = 659
+	srCyrlXKIndex     ID = 660
+	srLatnIndex       ID = 661
+	srLatnBAIndex     ID = 662
+	srLatnMEIndex     ID = 663
+	srLatnRSIndex     ID = 664
+	srLatnXKIndex     ID = 665
+	ssIndex           ID = 666
+	ssyIndex          ID = 667
+	stIndex           ID = 668
+	svIndex           ID = 669
+	svAXIndex         ID = 670
+	svFIIndex         ID = 671
+	svSEIndex         ID = 672
+	swIndex           ID = 673
+	swCDIndex         ID = 674
+	swKEIndex         ID = 675
+	swTZIndex         ID = 676
+	swUGIndex         ID = 677
+	syrIndex          ID = 678
+	taIndex           ID = 679
+	taINIndex         ID = 680
+	taLKIndex         ID = 681
+	taMYIndex         ID = 682
+	taSGIndex         ID = 683
+	teIndex           ID = 684
+	teINIndex         ID = 685
+	teoIndex          ID = 686
+	teoKEIndex        ID = 687
+	teoUGIndex        ID = 688
+	tgIndex           ID = 689
+	tgTJIndex         ID = 690
+	thIndex           ID = 691
+	thTHIndex         ID = 692
+	tiIndex           ID = 693
+	tiERIndex         ID = 694
+	tiETIndex         ID = 695
+	tigIndex          ID = 696
+	tkIndex           ID = 697
+	tkTMIndex         ID = 698
+	tlIndex           ID = 699
+	tnIndex           ID = 700
+	toIndex           ID = 701
+	toTOIndex         ID = 702
+	trIndex           ID = 703
+	trCYIndex         ID = 704
+	trTRIndex         ID = 705
+	tsIndex           ID = 706
+	ttIndex           ID = 707
+	ttRUIndex         ID = 708
+	twqIndex          ID = 709
+	twqNEIndex        ID = 710
+	tzmIndex          ID = 711
+	tzmMAIndex        ID = 712
+	ugIndex           ID = 713
+	ugCNIndex         ID = 714
+	ukIndex           ID = 715
+	ukUAIndex         ID = 716
+	urIndex           ID = 717
+	urINIndex         ID = 718
+	urPKIndex         ID = 719
+	uzIndex           ID = 720
+	uzArabIndex       ID = 721
+	uzArabAFIndex     ID = 722
+	uzCyrlIndex       ID = 723
+	uzCyrlUZIndex     ID = 724
+	uzLatnIndex       ID = 725
+	uzLatnUZIndex     ID = 726
+	vaiIndex          ID = 727
+	vaiLatnIndex      ID = 728
+	vaiLatnLRIndex    ID = 729
+	vaiVaiiIndex      ID = 730
+	vaiVaiiLRIndex    ID = 731
+	veIndex           ID = 732
+	viIndex           ID = 733
+	viVNIndex         ID = 734
+	voIndex           ID = 735
+	vo001Index        ID = 736
+	vunIndex          ID = 737
+	vunTZIndex        ID = 738
+	waIndex           ID = 739
+	waeIndex          ID = 740
+	waeCHIndex        ID = 741
+	woIndex           ID = 742
+	woSNIndex         ID = 743
+	xhIndex           ID = 744
+	xogIndex          ID = 745
+	xogUGIndex        ID = 746
+	yavIndex          ID = 747
+	yavCMIndex        ID = 748
+	yiIndex           ID = 749
+	yi001Index        ID = 750
+	yoIndex           ID = 751
+	yoBJIndex         ID = 752
+	yoNGIndex         ID = 753
+	yueIndex          ID = 754
+	yueHansIndex      ID = 755
+	yueHansCNIndex    ID = 756
+	yueHantIndex      ID = 757
+	yueHantHKIndex    ID = 758
+	zghIndex          ID = 759
+	zghMAIndex        ID = 760
+	zhIndex           ID = 761
+	zhHansIndex       ID = 762
+	zhHansCNIndex     ID = 763
+	zhHansHKIndex     ID = 764
+	zhHansMOIndex     ID = 765
+	zhHansSGIndex     ID = 766
+	zhHantIndex       ID = 767
+	zhHantHKIndex     ID = 768
+	zhHantMOIndex     ID = 769
+	zhHantTWIndex     ID = 770
+	zuIndex           ID = 771
+	zuZAIndex         ID = 772
+	caESvalenciaIndex ID = 773
+	enUSuvaposixIndex ID = 774
+)
+
+var coreTags = []language.CompactCoreInfo{ // 773 elements
+	// Entry 0 - 1F
+	0x00000000, 0x01600000, 0x016000d3, 0x01600162,
+	0x01c00000, 0x01c00052, 0x02100000, 0x02100081,
+	0x02700000, 0x02700070, 0x03a00000, 0x03a00001,
+	0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068,
+	0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098,
+	0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad,
+	0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca,
+	0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109,
+	// Entry 20 - 3F
+	0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d,
+	0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000,
+	0x04300000, 0x0430009a, 0x04400000, 0x04400130,
+	0x04800000, 0x0480006f, 0x05800000, 0x05820000,
+	0x05820032, 0x0585b000, 0x0585b032, 0x05e00000,
+	0x05e00052, 0x07100000, 0x07100047, 0x07500000,
+	0x07500163, 0x07900000, 0x07900130, 0x07e00000,
+	0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4,
+	// Entry 40 - 5F
+	0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000,
+	0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079,
+	0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000,
+	0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000,
+	0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f,
+	0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000,
+	0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000,
+	0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d,
+	// Entry 60 - 7F
+	0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107,
+	0x10000000, 0x1000007c, 0x10100000, 0x10100064,
+	0x10100083, 0x10800000, 0x108000a5, 0x10d00000,
+	0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061,
+	0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000,
+	0x117000d5, 0x11f00000, 0x11f00061, 0x12400000,
+	0x12400052, 0x12800000, 0x12b00000, 0x12b00115,
+	0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5,
+	// Entry 80 - 9F
+	0x13000000, 0x13000081, 0x13000123, 0x13600000,
+	0x1360005e, 0x13600088, 0x13900000, 0x13900001,
+	0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
+	0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
+	0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
+	0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
+	0x13900050, 0x13900052, 0x1390005d, 0x1390005e,
+	0x13900061, 0x13900062, 0x13900064, 0x13900065,
+	// Entry A0 - BF
+	0x1390006e, 0x13900073, 0x13900074, 0x13900075,
+	0x13900076, 0x1390007c, 0x1390007d, 0x13900080,
+	0x13900081, 0x13900082, 0x13900084, 0x1390008b,
+	0x1390008d, 0x1390008e, 0x13900097, 0x13900098,
+	0x13900099, 0x1390009a, 0x1390009b, 0x139000a0,
+	0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa,
+	0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6,
+	0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8,
+	// Entry C0 - DF
+	0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf,
+	0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7,
+	0x139000da, 0x139000de, 0x139000e0, 0x139000e1,
+	0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec,
+	0x139000ed, 0x139000f1, 0x13900108, 0x1390010a,
+	0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e,
+	0x1390010f, 0x13900110, 0x13900113, 0x13900118,
+	0x1390011c, 0x1390011e, 0x13900120, 0x13900126,
+	// Entry E0 - FF
+	0x1390012a, 0x1390012d, 0x1390012e, 0x13900130,
+	0x13900132, 0x13900134, 0x13900136, 0x1390013a,
+	0x1390013d, 0x1390013e, 0x13900140, 0x13900143,
+	0x13900162, 0x13900163, 0x13900165, 0x13c00000,
+	0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
+	0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
+	0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066,
+	0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087,
+	// Entry 100 - 11F
+	0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0,
+	0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8,
+	0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136,
+	0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b,
+	0x14500000, 0x1450006f, 0x14600000, 0x14600052,
+	0x14800000, 0x14800024, 0x1480009d, 0x14e00000,
+	0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115,
+	0x15100000, 0x15100073, 0x15300000, 0x153000e8,
+	// Entry 120 - 13F
+	0x15800000, 0x15800064, 0x15800077, 0x15e00000,
+	0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
+	0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
+	0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
+	0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b,
+	0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087,
+	0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb,
+	0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4,
+	// Entry 140 - 15F
+	0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4,
+	0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103,
+	0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d,
+	0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140,
+	0x15e00141, 0x15e00160, 0x16900000, 0x1690009f,
+	0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097,
+	0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f,
+	0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3,
+	// Entry 160 - 17F
+	0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000,
+	0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000,
+	0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000,
+	0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000,
+	0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091,
+	0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093,
+	0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096,
+	0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053,
+	// Entry 180 - 19F
+	0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e,
+	0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114,
+	0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000,
+	0x200000a3, 0x20300000, 0x20700000, 0x20700052,
+	0x20800000, 0x20a00000, 0x20a00130, 0x20e00000,
+	0x20f00000, 0x21000000, 0x2100007e, 0x21200000,
+	0x21200068, 0x21600000, 0x21700000, 0x217000a5,
+	0x21f00000, 0x22300000, 0x22300130, 0x22700000,
+	// Entry 1A0 - 1BF
+	0x2270005b, 0x23400000, 0x234000c4, 0x23900000,
+	0x239000a5, 0x24200000, 0x242000af, 0x24400000,
+	0x24400052, 0x24500000, 0x24500083, 0x24600000,
+	0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000,
+	0x2510009a, 0x25400000, 0x254000ab, 0x254000ac,
+	0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a,
+	0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052,
+	0x26e00000, 0x26e00061, 0x27400000, 0x28100000,
+	// Entry 1C0 - 1DF
+	0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000,
+	0x29100130, 0x29500000, 0x295000b8, 0x2a300000,
+	0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000,
+	0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
+	0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c,
+	0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000,
+	0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000,
+	0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000,
+	// Entry 1E0 - 1FF
+	0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5,
+	0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0,
+	0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052,
+	0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a,
+	0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000,
+	0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1,
+	0x31f0010e, 0x32000000, 0x320000cc, 0x32500000,
+	0x32500052, 0x33100000, 0x331000c5, 0x33a00000,
+	// Entry 200 - 21F
+	0x33a0009d, 0x34100000, 0x34500000, 0x345000d3,
+	0x34700000, 0x347000db, 0x34700111, 0x34e00000,
+	0x34e00165, 0x35000000, 0x35000061, 0x350000da,
+	0x35100000, 0x3510009a, 0x351000dc, 0x36700000,
+	0x36700030, 0x36700036, 0x36700040, 0x3670005c,
+	0x367000da, 0x36700117, 0x3670011c, 0x36800000,
+	0x36800052, 0x36a00000, 0x36a000db, 0x36c00000,
+	0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
+	// Entry 220 - 23F
+	0x37a00000, 0x38000000, 0x38000118, 0x38700000,
+	0x38900000, 0x38900132, 0x39000000, 0x39000070,
+	0x390000a5, 0x39500000, 0x3950009a, 0x39800000,
+	0x3980007e, 0x39800107, 0x39d00000, 0x39d05000,
+	0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000,
+	0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001,
+	0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
+	0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087,
+	// Entry 240 - 25F
+	0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2,
+	0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000,
+	0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000,
+	0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
+	0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130,
+	0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af,
+	0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000,
+	0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000,
+	// Entry 260 - 27F
+	0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000,
+	0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000,
+	0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d,
+	0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4,
+	0x40200000, 0x4020004c, 0x40700000, 0x40800000,
+	0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb,
+	0x40c00000, 0x40c000b4, 0x41200000, 0x41200112,
+	0x41600000, 0x41600110, 0x41c00000, 0x41d00000,
+	// Entry 280 - 29F
+	0x41e00000, 0x41f00000, 0x41f00073, 0x42200000,
+	0x42300000, 0x42300165, 0x42900000, 0x42900063,
+	0x42900070, 0x429000a5, 0x42900116, 0x43100000,
+	0x43100027, 0x431000c3, 0x4310014e, 0x43200000,
+	0x43220000, 0x43220033, 0x432200be, 0x43220106,
+	0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be,
+	0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000,
+	0x43b00000, 0x44400000, 0x44400031, 0x44400073,
+	// Entry 2A0 - 2BF
+	0x4440010d, 0x44500000, 0x4450004b, 0x445000a5,
+	0x44500130, 0x44500132, 0x44e00000, 0x45000000,
+	0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e,
+	0x46100000, 0x4610009a, 0x46400000, 0x464000a5,
+	0x46400132, 0x46700000, 0x46700125, 0x46b00000,
+	0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070,
+	0x47100000, 0x47600000, 0x47600128, 0x47a00000,
+	0x48000000, 0x48200000, 0x4820012a, 0x48a00000,
+	// Entry 2C0 - 2DF
+	0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000,
+	0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000,
+	0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+	0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9,
+	0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000,
+	0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000,
+	0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5,
+	0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000,
+	// Entry 2E0 - 2FF
+	0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000,
+	0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115,
+	0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000,
+	0x50900052, 0x51200000, 0x51200001, 0x51800000,
+	0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000,
+	0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000,
+	0x528000bb, 0x52900000, 0x5293b000, 0x5293b053,
+	0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000,
+	// Entry 300 - 31F
+	0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000,
+	0x52f00162,
+} // Size: 3116 bytes
+
+const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
+
+// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
new file mode 100644
index 0000000..ca135d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tags.go
@@ -0,0 +1,91 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package compact
+
+var (
+	und = Tag{}
+
+	Und Tag = Tag{}
+
+	Afrikaans            Tag = Tag{language: afIndex, locale: afIndex}
+	Amharic              Tag = Tag{language: amIndex, locale: amIndex}
+	Arabic               Tag = Tag{language: arIndex, locale: arIndex}
+	ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
+	Azerbaijani          Tag = Tag{language: azIndex, locale: azIndex}
+	Bulgarian            Tag = Tag{language: bgIndex, locale: bgIndex}
+	Bengali              Tag = Tag{language: bnIndex, locale: bnIndex}
+	Catalan              Tag = Tag{language: caIndex, locale: caIndex}
+	Czech                Tag = Tag{language: csIndex, locale: csIndex}
+	Danish               Tag = Tag{language: daIndex, locale: daIndex}
+	German               Tag = Tag{language: deIndex, locale: deIndex}
+	Greek                Tag = Tag{language: elIndex, locale: elIndex}
+	English              Tag = Tag{language: enIndex, locale: enIndex}
+	AmericanEnglish      Tag = Tag{language: enUSIndex, locale: enUSIndex}
+	BritishEnglish       Tag = Tag{language: enGBIndex, locale: enGBIndex}
+	Spanish              Tag = Tag{language: esIndex, locale: esIndex}
+	EuropeanSpanish      Tag = Tag{language: esESIndex, locale: esESIndex}
+	LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
+	Estonian             Tag = Tag{language: etIndex, locale: etIndex}
+	Persian              Tag = Tag{language: faIndex, locale: faIndex}
+	Finnish              Tag = Tag{language: fiIndex, locale: fiIndex}
+	Filipino             Tag = Tag{language: filIndex, locale: filIndex}
+	French               Tag = Tag{language: frIndex, locale: frIndex}
+	CanadianFrench       Tag = Tag{language: frCAIndex, locale: frCAIndex}
+	Gujarati             Tag = Tag{language: guIndex, locale: guIndex}
+	Hebrew               Tag = Tag{language: heIndex, locale: heIndex}
+	Hindi                Tag = Tag{language: hiIndex, locale: hiIndex}
+	Croatian             Tag = Tag{language: hrIndex, locale: hrIndex}
+	Hungarian            Tag = Tag{language: huIndex, locale: huIndex}
+	Armenian             Tag = Tag{language: hyIndex, locale: hyIndex}
+	Indonesian           Tag = Tag{language: idIndex, locale: idIndex}
+	Icelandic            Tag = Tag{language: isIndex, locale: isIndex}
+	Italian              Tag = Tag{language: itIndex, locale: itIndex}
+	Japanese             Tag = Tag{language: jaIndex, locale: jaIndex}
+	Georgian             Tag = Tag{language: kaIndex, locale: kaIndex}
+	Kazakh               Tag = Tag{language: kkIndex, locale: kkIndex}
+	Khmer                Tag = Tag{language: kmIndex, locale: kmIndex}
+	Kannada              Tag = Tag{language: knIndex, locale: knIndex}
+	Korean               Tag = Tag{language: koIndex, locale: koIndex}
+	Kirghiz              Tag = Tag{language: kyIndex, locale: kyIndex}
+	Lao                  Tag = Tag{language: loIndex, locale: loIndex}
+	Lithuanian           Tag = Tag{language: ltIndex, locale: ltIndex}
+	Latvian              Tag = Tag{language: lvIndex, locale: lvIndex}
+	Macedonian           Tag = Tag{language: mkIndex, locale: mkIndex}
+	Malayalam            Tag = Tag{language: mlIndex, locale: mlIndex}
+	Mongolian            Tag = Tag{language: mnIndex, locale: mnIndex}
+	Marathi              Tag = Tag{language: mrIndex, locale: mrIndex}
+	Malay                Tag = Tag{language: msIndex, locale: msIndex}
+	Burmese              Tag = Tag{language: myIndex, locale: myIndex}
+	Nepali               Tag = Tag{language: neIndex, locale: neIndex}
+	Dutch                Tag = Tag{language: nlIndex, locale: nlIndex}
+	Norwegian            Tag = Tag{language: noIndex, locale: noIndex}
+	Punjabi              Tag = Tag{language: paIndex, locale: paIndex}
+	Polish               Tag = Tag{language: plIndex, locale: plIndex}
+	Portuguese           Tag = Tag{language: ptIndex, locale: ptIndex}
+	BrazilianPortuguese  Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
+	EuropeanPortuguese   Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
+	Romanian             Tag = Tag{language: roIndex, locale: roIndex}
+	Russian              Tag = Tag{language: ruIndex, locale: ruIndex}
+	Sinhala              Tag = Tag{language: siIndex, locale: siIndex}
+	Slovak               Tag = Tag{language: skIndex, locale: skIndex}
+	Slovenian            Tag = Tag{language: slIndex, locale: slIndex}
+	Albanian             Tag = Tag{language: sqIndex, locale: sqIndex}
+	Serbian              Tag = Tag{language: srIndex, locale: srIndex}
+	SerbianLatin         Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
+	Swedish              Tag = Tag{language: svIndex, locale: svIndex}
+	Swahili              Tag = Tag{language: swIndex, locale: swIndex}
+	Tamil                Tag = Tag{language: taIndex, locale: taIndex}
+	Telugu               Tag = Tag{language: teIndex, locale: teIndex}
+	Thai                 Tag = Tag{language: thIndex, locale: thIndex}
+	Turkish              Tag = Tag{language: trIndex, locale: trIndex}
+	Ukrainian            Tag = Tag{language: ukIndex, locale: ukIndex}
+	Urdu                 Tag = Tag{language: urIndex, locale: urIndex}
+	Uzbek                Tag = Tag{language: uzIndex, locale: uzIndex}
+	Vietnamese           Tag = Tag{language: viIndex, locale: viIndex}
+	Chinese              Tag = Tag{language: zhIndex, locale: zhIndex}
+	SimplifiedChinese    Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
+	TraditionalChinese   Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
+	Zulu                 Tag = Tag{language: zuIndex, locale: zuIndex}
+)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
new file mode 100644
index 0000000..4ae78e0
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compose.go
@@ -0,0 +1,167 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"sort"
+	"strings"
+)
+
+// A Builder allows constructing a Tag from individual components.
+// Its main user is Compose in the top-level language package.
+type Builder struct {
+	Tag Tag
+
+	private    string // the x extension
+	variants   []string
+	extensions []string
+}
+
+// Make returns a new Tag from the current settings.
+func (b *Builder) Make() Tag {
+	t := b.Tag
+
+	if len(b.extensions) > 0 || len(b.variants) > 0 {
+		sort.Sort(sortVariants(b.variants))
+		sort.Strings(b.extensions)
+
+		if b.private != "" {
+			b.extensions = append(b.extensions, b.private)
+		}
+		n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
+		buf := make([]byte, n)
+		p := t.genCoreBytes(buf)
+		t.pVariant = byte(p)
+		p += appendTokens(buf[p:], b.variants...)
+		t.pExt = uint16(p)
+		p += appendTokens(buf[p:], b.extensions...)
+		t.str = string(buf[:p])
+		// We may not always need to remake the string, but when or when not
+		// to do so is rather tricky.
+		scan := makeScanner(buf[:p])
+		t, _ = parse(&scan, "")
+		return t
+
+	} else if b.private != "" {
+		t.str = b.private
+		t.RemakeString()
+	}
+	return t
+}
+
+// SetTag copies all the settings from a given Tag. Any previously set values
+// are discarded.
+func (b *Builder) SetTag(t Tag) {
+	b.Tag.LangID = t.LangID
+	b.Tag.RegionID = t.RegionID
+	b.Tag.ScriptID = t.ScriptID
+	// TODO: optimize
+	b.variants = b.variants[:0]
+	if variants := t.Variants(); variants != "" {
+		for _, vr := range strings.Split(variants[1:], "-") {
+			b.variants = append(b.variants, vr)
+		}
+	}
+	b.extensions, b.private = b.extensions[:0], ""
+	for _, e := range t.Extensions() {
+		b.AddExt(e)
+	}
+}
+
+// AddExt adds extension e to the tag. e must be a valid extension as returned
+// by Tag.Extension. If the extension already exists, it will be discarded,
+// except for a -u extension, where non-existing key-type pairs will added.
+func (b *Builder) AddExt(e string) {
+	if e[0] == 'x' {
+		if b.private == "" {
+			b.private = e
+		}
+		return
+	}
+	for i, s := range b.extensions {
+		if s[0] == e[0] {
+			if e[0] == 'u' {
+				b.extensions[i] += e[1:]
+			}
+			return
+		}
+	}
+	b.extensions = append(b.extensions, e)
+}
+
+// SetExt sets the extension e to the tag. e must be a valid extension as
+// returned by Tag.Extension. If the extension already exists, it will be
+// overwritten, except for a -u extension, where the individual key-type pairs
+// will be set.
+func (b *Builder) SetExt(e string) {
+	if e[0] == 'x' {
+		b.private = e
+		return
+	}
+	for i, s := range b.extensions {
+		if s[0] == e[0] {
+			if e[0] == 'u' {
+				b.extensions[i] = e + s[1:]
+			} else {
+				b.extensions[i] = e
+			}
+			return
+		}
+	}
+	b.extensions = append(b.extensions, e)
+}
+
+// AddVariant adds any number of variants.
+func (b *Builder) AddVariant(v ...string) {
+	for _, v := range v {
+		if v != "" {
+			b.variants = append(b.variants, v)
+		}
+	}
+}
+
+// ClearVariants removes any variants previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearVariants() {
+	b.variants = b.variants[:0]
+}
+
+// ClearExtensions removes any extensions previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearExtensions() {
+	b.private = ""
+	b.extensions = b.extensions[:0]
+}
+
+func tokenLen(token ...string) (n int) {
+	for _, t := range token {
+		n += len(t) + 1
+	}
+	return
+}
+
+func appendTokens(b []byte, token ...string) int {
+	p := 0
+	for _, t := range token {
+		b[p] = '-'
+		copy(b[p+1:], t)
+		p += 1 + len(t)
+	}
+	return p
+}
+
+type sortVariants []string
+
+func (s sortVariants) Len() int {
+	return len(s)
+}
+
+func (s sortVariants) Swap(i, j int) {
+	s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariants) Less(i, j int) bool {
+	return variantIndex[s[i]] < variantIndex[s[j]]
+}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
new file mode 100644
index 0000000..9b20b88
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/coverage.go
@@ -0,0 +1,28 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func BaseLanguages() []Language {
+	base := make([]Language, 0, NumLanguages)
+	for i := 0; i < langNoIndexOffset; i++ {
+		// We included "und" already for the value 0.
+		if i != nonCanonicalUnd {
+			base = append(base, Language(i))
+		}
+	}
+	i := langNoIndexOffset
+	for _, v := range langNoIndex {
+		for k := 0; k < 8; k++ {
+			if v&1 == 1 {
+				base = append(base, Language(i))
+			}
+			v >>= 1
+			i++
+		}
+	}
+	return base
+}
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
new file mode 100644
index 0000000..09d41c7
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/language.go
@@ -0,0 +1,627 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+
+package language // import "golang.org/x/text/internal/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+	"errors"
+	"fmt"
+	"strings"
+)
+
+const (
+	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
+	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+	maxCoreSize = 12
+
+	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+	// is large enough to hold at least 99% of the BCP 47 tags.
+	max99thPercentileSize = 32
+
+	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
+	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+	maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed. The zero value of Tag is Und.
+type Tag struct {
+	// TODO: the following fields have the form TagTypeID. This name is chosen
+	// to allow refactoring the public package without conflicting with its
+	// Base, Script, and Region methods. Once the transition is fully completed
+	// the ID can be stripped from the name.
+
+	LangID   Language
+	RegionID Region
+	// TODO: we will soon run out of positions for ScriptID. Idea: instead of
+	// storing lang, region, and ScriptID codes, store only the compact index and
+	// have a lookup table from this code to its expansion. This greatly speeds
+	// up table lookup, speed up common variant cases.
+	// This will also immediately free up 3 extra bytes. Also, the pVariant
+	// field can now be moved to the lookup table, as the compact index uniquely
+	// determines the offset of a possible variant.
+	ScriptID Script
+	pVariant byte   // offset in str, includes preceding '-'
+	pExt     uint16 // offset of first extension, includes preceding '-'
+
+	// str is the string representation of the Tag. It will only be used if the
+	// tag has variants or extensions.
+	str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+	t, _ := Parse(s)
+	return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+// TODO: consider removing
+func (t Tag) Raw() (b Language, s Script, r Region) {
+	return t.LangID, t.ScriptID, t.RegionID
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+	return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+	if int(t.pVariant) < len(t.str) {
+		return false
+	}
+	return t.equalTags(Und)
+}
+
+// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
+// tag.
+func (t Tag) IsPrivateUse() bool {
+	return t.str != "" && t.pVariant == 0
+}
+
+// RemakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) RemakeString() {
+	if t.str == "" {
+		return
+	}
+	extra := t.str[t.pVariant:]
+	if t.pVariant > 0 {
+		extra = extra[1:]
+	}
+	if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
+		t.str = extra
+		t.pVariant = 0
+		t.pExt = 0
+		return
+	}
+	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+	b := buf[:t.genCoreBytes(buf[:])]
+	if extra != "" {
+		diff := len(b) - int(t.pVariant)
+		b = append(b, '-')
+		b = append(b, extra...)
+		t.pVariant = uint8(int(t.pVariant) + diff)
+		t.pExt = uint16(int(t.pExt) + diff)
+	} else {
+		t.pVariant = uint8(len(b))
+		t.pExt = uint16(len(b))
+	}
+	t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+	n := t.LangID.StringToBuf(buf[:])
+	if t.ScriptID != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.ScriptID.String())
+	}
+	if t.RegionID != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.RegionID.String())
+	}
+	return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+	if t.str != "" {
+		return t.str
+	}
+	if t.ScriptID == 0 && t.RegionID == 0 {
+		return t.LangID.String()
+	}
+	buf := [maxCoreSize]byte{}
+	return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+	if t.str != "" {
+		text = append(text, t.str...)
+	} else if t.ScriptID == 0 && t.RegionID == 0 {
+		text = append(text, t.LangID.String()...)
+	} else {
+		buf := [maxCoreSize]byte{}
+		text = buf[:t.genCoreBytes(buf[:])]
+	}
+	return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+	tag, err := Parse(string(text))
+	*t = tag
+	return err
+}
+
+// Variants returns the part of the tag holding all variants or the empty string
+// if there are no variants defined.
+func (t Tag) Variants() string {
+	if t.pVariant == 0 {
+		return ""
+	}
+	return t.str[t.pVariant:t.pExt]
+}
+
+// VariantOrPrivateUseTags returns variants or private use tags.
+func (t Tag) VariantOrPrivateUseTags() string {
+	if t.pExt > 0 {
+		return t.str[t.pVariant:t.pExt]
+	}
+	return t.str[t.pVariant:]
+}
+
+// HasString reports whether this tag defines more than just the raw
+// components.
+func (t Tag) HasString() bool {
+	return t.str != ""
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+	if t.str != "" {
+		// Strip the variants and extensions.
+		b, s, r := t.Raw()
+		t = Tag{LangID: b, ScriptID: s, RegionID: r}
+		if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID == t.ScriptID {
+				return Tag{LangID: t.LangID}
+			}
+		}
+		return t
+	}
+	if t.LangID != 0 {
+		if t.RegionID != 0 {
+			maxScript := t.ScriptID
+			if maxScript == 0 {
+				max, _ := addTags(t)
+				maxScript = max.ScriptID
+			}
+
+			for i := range parents {
+				if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
+					for _, r := range parents[i].fromRegion {
+						if Region(r) == t.RegionID {
+							return Tag{
+								LangID:   t.LangID,
+								ScriptID: Script(parents[i].script),
+								RegionID: Region(parents[i].toRegion),
+							}
+						}
+					}
+				}
+			}
+
+			// Strip the script if it is the default one.
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID != maxScript {
+				return Tag{LangID: t.LangID, ScriptID: maxScript}
+			}
+			return Tag{LangID: t.LangID}
+		} else if t.ScriptID != 0 {
+			// The parent for an base-script pair with a non-default script is
+			// "und" instead of the base language.
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID != t.ScriptID {
+				return Und
+			}
+			return Tag{LangID: t.LangID}
+		}
+	}
+	return Und
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (ext string, err error) {
+	defer func() {
+		if recover() != nil {
+			ext = ""
+			err = ErrSyntax
+		}
+	}()
+
+	scan := makeScannerString(s)
+	var end int
+	if n := len(scan.token); n != 1 {
+		return "", ErrSyntax
+	}
+	scan.toLower(0, len(scan.b))
+	end = parseExtension(&scan)
+	if end != len(s) {
+		return "", ErrSyntax
+	}
+	return string(scan.b), nil
+}
+
+// HasVariants reports whether t has variants.
+func (t Tag) HasVariants() bool {
+	return uint16(t.pVariant) < t.pExt
+}
+
+// HasExtensions reports whether t has extensions.
+func (t Tag) HasExtensions() bool {
+	return int(t.pExt) < len(t.str)
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext string, ok bool) {
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		if ext[0] == x {
+			return ext, true
+		}
+	}
+	return "", false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []string {
+	e := []string{}
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		e = append(e, ext)
+	}
+	return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+//
+// If there are multiple types associated with a key, only the first will be
+// returned. If there is no type associated with a key, it returns the empty
+// string.
+func (t Tag) TypeForKey(key string) string {
+	if _, start, end, _ := t.findTypeForKey(key); end != start {
+		s := t.str[start:end]
+		if p := strings.IndexByte(s, '-'); p >= 0 {
+			s = s[:p]
+		}
+		return s
+	}
+	return ""
+}
+
+var (
+	errPrivateUse       = errors.New("cannot set a key on a private use tag")
+	errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+	if t.IsPrivateUse() {
+		return t, errPrivateUse
+	}
+	if len(key) != 2 {
+		return t, errInvalidArguments
+	}
+
+	// Remove the setting if value is "".
+	if value == "" {
+		start, sep, end, _ := t.findTypeForKey(key)
+		if start != sep {
+			// Remove a possible empty extension.
+			switch {
+			case t.str[start-2] != '-': // has previous elements.
+			case end == len(t.str), // end of string
+				end+2 < len(t.str) && t.str[end+2] == '-': // end of extension
+				start -= 2
+			}
+			if start == int(t.pVariant) && end == len(t.str) {
+				t.str = ""
+				t.pVariant, t.pExt = 0, 0
+			} else {
+				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+			}
+		}
+		return t, nil
+	}
+
+	if len(value) < 3 || len(value) > 8 {
+		return t, errInvalidArguments
+	}
+
+	var (
+		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
+		uStart int // start of the -u extension.
+	)
+
+	// Generate the tag string if needed.
+	if t.str == "" {
+		uStart = t.genCoreBytes(buf[:])
+		buf[uStart] = '-'
+		uStart++
+	}
+
+	// Create new key-type pair and parse it to verify.
+	b := buf[uStart:]
+	copy(b, "u-")
+	copy(b[2:], key)
+	b[4] = '-'
+	b = b[:5+copy(b[5:], value)]
+	scan := makeScanner(b)
+	if parseExtensions(&scan); scan.err != nil {
+		return t, scan.err
+	}
+
+	// Assemble the replacement string.
+	if t.str == "" {
+		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+		t.str = string(buf[:uStart+len(b)])
+	} else {
+		s := t.str
+		start, sep, end, hasExt := t.findTypeForKey(key)
+		if start == sep {
+			if hasExt {
+				b = b[2:]
+			}
+			t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:])
+		} else {
+			t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:])
+		}
+	}
+	return t, nil
+}
+
+// findTypeForKey returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) {
+	p := int(t.pExt)
+	if len(key) != 2 || p == len(t.str) || p == 0 {
+		return p, p, p, false
+	}
+	s := t.str
+
+	// Find the correct extension.
+	for p++; s[p] != 'u'; p++ {
+		if s[p] > 'u' {
+			p--
+			return p, p, p, false
+		}
+		if p = nextExtension(s, p); p == len(s) {
+			return len(s), len(s), len(s), false
+		}
+	}
+	// Proceed to the hyphen following the extension name.
+	p++
+
+	// curKey is the key currently being processed.
+	curKey := ""
+
+	// Iterate over keys until we get the end of a section.
+	for {
+		end = p
+		for p++; p < len(s) && s[p] != '-'; p++ {
+		}
+		n := p - end - 1
+		if n <= 2 && curKey == key {
+			if sep < end {
+				sep++
+			}
+			return start, sep, end, true
+		}
+		switch n {
+		case 0, // invalid string
+			1: // next extension
+			return end, end, end, true
+		case 2:
+			// next key
+			curKey = s[end+1 : p]
+			if curKey > key {
+				return end, end, end, true
+			}
+			start = end
+			sep = p
+		}
+	}
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (l Language, err error) {
+	defer func() {
+		if recover() != nil {
+			l = 0
+			err = ErrSyntax
+		}
+	}()
+
+	if n := len(s); n < 2 || 3 < n {
+		return 0, ErrSyntax
+	}
+	var buf [3]byte
+	return getLangID(buf[:copy(buf[:], s)])
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (scr Script, err error) {
+	defer func() {
+		if recover() != nil {
+			scr = 0
+			err = ErrSyntax
+		}
+	}()
+
+	if len(s) != 4 {
+		return 0, ErrSyntax
+	}
+	var buf [4]byte
+	return getScriptID(script, buf[:copy(buf[:], s)])
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+	return getRegionM49(r)
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (r Region, err error) {
+	defer func() {
+		if recover() != nil {
+			r = 0
+			err = ErrSyntax
+		}
+	}()
+
+	if n := len(s); n < 2 || 3 < n {
+		return 0, ErrSyntax
+	}
+	var buf [3]byte
+	return getRegionID(buf[:copy(buf[:], s)])
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+	if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
+		return false
+	}
+	return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+	if r == 0 {
+		return false
+	}
+	return int(regionInclusion[r]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+	if r == c {
+		return true
+	}
+	g := regionInclusion[r]
+	if g >= nRegionGroups {
+		return false
+	}
+	m := regionContainment[g]
+
+	d := regionInclusion[c]
+	b := regionInclusionBits[d]
+
+	// A contained country may belong to multiple disjoint groups. Matching any
+	// of these indicates containment. If the contained region is a group, it
+	// must strictly be a subset.
+	if d >= nRegionGroups {
+		return b&m != 0
+	}
+	return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+	// difference between ISO 3166-1 and IANA ccTLD.
+	if r == _GB {
+		r = _UK
+	}
+	if (r.typ() & ccTLD) == 0 {
+		return 0, errNoTLD
+	}
+	return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+	if cr := normRegion(r); cr != 0 {
+		return cr
+	}
+	return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+	ID  uint8
+	str string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (v Variant, err error) {
+	defer func() {
+		if recover() != nil {
+			v = Variant{}
+			err = ErrSyntax
+		}
+	}()
+
+	s = strings.ToLower(s)
+	if id, ok := variantIndex[s]; ok {
+		return Variant{id, s}, nil
+	}
+	return Variant{}, NewValueError([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+	return v.str
+}
diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
new file mode 100644
index 0000000..231b4fb
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/lookup.go
@@ -0,0 +1,412 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"bytes"
+	"fmt"
+	"sort"
+	"strconv"
+
+	"golang.org/x/text/internal/tag"
+)
+
+// findIndex tries to find the given tag in idx and returns a standardized error
+// if it could not be found.
+func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
+	if !tag.FixCase(form, key) {
+		return 0, ErrSyntax
+	}
+	i := idx.Index(key)
+	if i == -1 {
+		return 0, NewValueError(key)
+	}
+	return i, nil
+}
+
+func searchUint(imap []uint16, key uint16) int {
+	return sort.Search(len(imap), func(i int) bool {
+		return imap[i] >= key
+	})
+}
+
+type Language uint16
+
+// getLangID returns the langID of s if s is a canonical subtag
+// or langUnknown if s is not a canonical subtag.
+func getLangID(s []byte) (Language, error) {
+	if len(s) == 2 {
+		return getLangISO2(s)
+	}
+	return getLangISO3(s)
+}
+
+// TODO language normalization as well as the AliasMaps could be moved to the
+// higher level package, but it is a bit tricky to separate the generation.
+
+func (id Language) Canonicalize() (Language, AliasType) {
+	return normLang(id)
+}
+
+// normLang returns the mapped langID of id according to mapping m.
+func normLang(id Language) (Language, AliasType) {
+	k := sort.Search(len(AliasMap), func(i int) bool {
+		return AliasMap[i].From >= uint16(id)
+	})
+	if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
+		return Language(AliasMap[k].To), AliasTypes[k]
+	}
+	return id, AliasTypeUnknown
+}
+
+// getLangISO2 returns the langID for the given 2-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO2(s []byte) (Language, error) {
+	if !tag.FixCase("zz", s) {
+		return 0, ErrSyntax
+	}
+	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
+		return Language(i), nil
+	}
+	return 0, NewValueError(s)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s []byte) uint {
+	v := uint(0)
+	for i := 0; i < len(s); i++ {
+		v *= base
+		v += uint(s[i] - 'a')
+	}
+	return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+	for i := len(s) - 1; i >= 0; i-- {
+		s[i] = byte(v%base) + 'a'
+		v /= base
+	}
+}
+
+// getLangISO3 returns the langID for the given 3-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO3(s []byte) (Language, error) {
+	if tag.FixCase("und", s) {
+		// first try to match canonical 3-letter entries
+		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
+			if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
+				// We treat "und" as special and always translate it to "unspecified".
+				// Note that ZZ and Zzzz are private use and are not treated as
+				// unspecified by default.
+				id := Language(i)
+				if id == nonCanonicalUnd {
+					return 0, nil
+				}
+				return id, nil
+			}
+		}
+		if i := altLangISO3.Index(s); i != -1 {
+			return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+		}
+		n := strToInt(s)
+		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
+			return Language(n) + langNoIndexOffset, nil
+		}
+		// Check for non-canonical uses of ISO3.
+		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
+			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
+				return Language(i), nil
+			}
+		}
+		return 0, NewValueError(s)
+	}
+	return 0, ErrSyntax
+}
+
+// StringToBuf writes the string to b and returns the number of bytes
+// written.  cap(b) must be >= 3.
+func (id Language) StringToBuf(b []byte) int {
+	if id >= langNoIndexOffset {
+		intToStr(uint(id)-langNoIndexOffset, b[:3])
+		return 3
+	} else if id == 0 {
+		return copy(b, "und")
+	}
+	l := lang[id<<2:]
+	if l[3] == 0 {
+		return copy(b, l[:3])
+	}
+	return copy(b, l[:2])
+}
+
+// String returns the BCP 47 representation of the langID.
+// Use b as variable name, instead of id, to ensure the variable
+// used is consistent with that of Base in which this type is embedded.
+func (b Language) String() string {
+	if b == 0 {
+		return "und"
+	} else if b >= langNoIndexOffset {
+		b -= langNoIndexOffset
+		buf := [3]byte{}
+		intToStr(uint(b), buf[:])
+		return string(buf[:])
+	}
+	l := lang.Elem(int(b))
+	if l[3] == 0 {
+		return l[:3]
+	}
+	return l[:2]
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Language) ISO3() string {
+	if b == 0 || b >= langNoIndexOffset {
+		return b.String()
+	}
+	l := lang.Elem(int(b))
+	if l[3] == 0 {
+		return l[:3]
+	} else if l[2] == 0 {
+		return altLangISO3.Elem(int(l[3]))[:3]
+	}
+	// This allocation will only happen for 3-letter ISO codes
+	// that are non-canonical BCP 47 language identifiers.
+	return l[0:1] + l[2:4]
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Language) IsPrivateUse() bool {
+	return langPrivateStart <= b && b <= langPrivateEnd
+}
+
+// SuppressScript returns the script marked as SuppressScript in the IANA
+// language tag repository, or 0 if there is no such script.
+func (b Language) SuppressScript() Script {
+	if b < langNoIndexOffset {
+		return Script(suppressScript[b])
+	}
+	return 0
+}
+
+type Region uint16
+
+// getRegionID returns the region id for s if s is a valid 2-letter region code
+// or unknownRegion.
+func getRegionID(s []byte) (Region, error) {
+	if len(s) == 3 {
+		if isAlpha(s[0]) {
+			return getRegionISO3(s)
+		}
+		if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
+			return getRegionM49(int(i))
+		}
+	}
+	return getRegionISO2(s)
+}
+
+// getRegionISO2 returns the regionID for the given 2-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO2(s []byte) (Region, error) {
+	i, err := findIndex(regionISO, s, "ZZ")
+	if err != nil {
+		return 0, err
+	}
+	return Region(i) + isoRegionOffset, nil
+}
+
+// getRegionISO3 returns the regionID for the given 3-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO3(s []byte) (Region, error) {
+	if tag.FixCase("ZZZ", s) {
+		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
+			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
+				return Region(i) + isoRegionOffset, nil
+			}
+		}
+		for i := 0; i < len(altRegionISO3); i += 3 {
+			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
+				return Region(altRegionIDs[i/3]), nil
+			}
+		}
+		return 0, NewValueError(s)
+	}
+	return 0, ErrSyntax
+}
+
+func getRegionM49(n int) (Region, error) {
+	if 0 < n && n <= 999 {
+		const (
+			searchBits = 7
+			regionBits = 9
+			regionMask = 1<<regionBits - 1
+		)
+		idx := n >> searchBits
+		buf := fromM49[m49Index[idx]:m49Index[idx+1]]
+		val := uint16(n) << regionBits // we rely on bits shifting out
+		i := sort.Search(len(buf), func(i int) bool {
+			return buf[i] >= val
+		})
+		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
+			return Region(r & regionMask), nil
+		}
+	}
+	var e ValueError
+	fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
+	return 0, e
+}
+
+// normRegion returns a region if r is deprecated or 0 otherwise.
+// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
+// TODO: consider mapping split up regions to new most populous one (like CLDR).
+func normRegion(r Region) Region {
+	m := regionOldMap
+	k := sort.Search(len(m), func(i int) bool {
+		return m[i].From >= uint16(r)
+	})
+	if k < len(m) && m[k].From == uint16(r) {
+		return Region(m[k].To)
+	}
+	return 0
+}
+
+const (
+	iso3166UserAssigned = 1 << iota
+	ccTLD
+	bcp47Region
+)
+
+func (r Region) typ() byte {
+	return regionTypes[r]
+}
+
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+	if r < isoRegionOffset {
+		if r == 0 {
+			return "ZZ"
+		}
+		return fmt.Sprintf("%03d", r.M49())
+	}
+	r -= isoRegionOffset
+	return regionISO.Elem(int(r))[:2]
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+	if r < isoRegionOffset {
+		return "ZZZ"
+	}
+	r -= isoRegionOffset
+	reg := regionISO.Elem(int(r))
+	switch reg[2] {
+	case 0:
+		return altRegionISO3[reg[3]:][:3]
+	case ' ':
+		return "ZZZ"
+	}
+	return reg[0:1] + reg[2:4]
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+	return int(m49[r])
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+	return r.typ()&iso3166UserAssigned != 0
+}
+
+type Script uint16
+
+// getScriptID returns the script id for string s. It assumes that s
+// is of the format [A-Z][a-z]{3}.
+func getScriptID(idx tag.Index, s []byte) (Script, error) {
+	i, err := findIndex(idx, s, "Zzzz")
+	return Script(i), err
+}
+
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+	if s == 0 {
+		return "Zzzz"
+	}
+	return script.Elem(int(s))
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+	return _Qaaa <= s && s <= _Qabx
+}
+
+const (
+	maxAltTaglen = len("en-US-POSIX")
+	maxLen       = maxAltTaglen
+)
+
+var (
+	// grandfatheredMap holds a mapping from legacy and grandfathered tags to
+	// their base language or index to more elaborate tag.
+	grandfatheredMap = map[[maxLen]byte]int16{
+		[maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
+		[maxLen]byte{'i', '-', 'a', 'm', 'i'}:                          _ami, // i-ami
+		[maxLen]byte{'i', '-', 'b', 'n', 'n'}:                          _bnn, // i-bnn
+		[maxLen]byte{'i', '-', 'h', 'a', 'k'}:                          _hak, // i-hak
+		[maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}:      _tlh, // i-klingon
+		[maxLen]byte{'i', '-', 'l', 'u', 'x'}:                          _lb,  // i-lux
+		[maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}:           _nv,  // i-navajo
+		[maxLen]byte{'i', '-', 'p', 'w', 'n'}:                          _pwn, // i-pwn
+		[maxLen]byte{'i', '-', 't', 'a', 'o'}:                          _tao, // i-tao
+		[maxLen]byte{'i', '-', 't', 'a', 'y'}:                          _tay, // i-tay
+		[maxLen]byte{'i', '-', 't', 's', 'u'}:                          _tsu, // i-tsu
+		[maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}:                     _nb,  // no-bok
+		[maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}:                     _nn,  // no-nyn
+		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}:      _sfb, // sgn-BE-FR
+		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}:      _vgt, // sgn-BE-NL
+		[maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}:      _sgg, // sgn-CH-DE
+		[maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}:           _cmn, // zh-guoyu
+		[maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}:           _hak, // zh-hakka
+		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
+		[maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}:           _hsn, // zh-xiang
+
+		// Grandfathered tags with no modern replacement will be converted as
+		// follows:
+		[maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
+		[maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}:           -2, // en-GB-oed
+		[maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}:           -3, // i-default
+		[maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}:      -4, // i-enochian
+		[maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}:                     -5, // i-mingo
+		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}:                          -6, // zh-min
+
+		// CLDR-specific tag.
+		[maxLen]byte{'r', 'o', 'o', 't'}:                                    0,  // root
+		[maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
+	}
+
+	altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
+
+	altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
+)
+
+func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
+	if v, ok := grandfatheredMap[s]; ok {
+		if v < 0 {
+			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
+		}
+		t.LangID = Language(v)
+		return t, true
+	}
+	return t, false
+}
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
new file mode 100644
index 0000000..75a2dbc
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/match.go
@@ -0,0 +1,226 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+type scriptRegionFlags uint8
+
+const (
+	isList = 1 << iota
+	scriptInFrom
+	regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id Language) {
+	if t.LangID == 0 {
+		t.LangID = id
+	}
+}
+
+func (t *Tag) setUndefinedScript(id Script) {
+	if t.ScriptID == 0 {
+		t.ScriptID = id
+	}
+}
+
+func (t *Tag) setUndefinedRegion(id Region) {
+	if t.RegionID == 0 || t.RegionID.Contains(id) {
+		t.RegionID = id
+	}
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+	id, err := addTags(t)
+	if err != nil {
+		return t, err
+	} else if id.equalTags(t) {
+		return t, nil
+	}
+	id.RemakeString()
+	return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+	if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+		x := likelyRegionGroup[i]
+		if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
+			t.RegionID = Region(x.region)
+		}
+		return true
+	}
+	return false
+}
+
+// Maximize returns a new tag with missing tags filled in.
+func (t Tag) Maximize() (Tag, error) {
+	return addTags(t)
+}
+
+func addTags(t Tag) (Tag, error) {
+	// We leave private use identifiers alone.
+	if t.IsPrivateUse() {
+		return t, nil
+	}
+	if t.ScriptID != 0 && t.RegionID != 0 {
+		if t.LangID != 0 {
+			// already fully specified
+			specializeRegion(&t)
+			return t, nil
+		}
+		// Search matches for und-script-region. Note that for these cases
+		// region will never be a group so there is no need to check for this.
+		list := likelyRegion[t.RegionID : t.RegionID+1]
+		if x := list[0]; x.flags&isList != 0 {
+			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+		}
+		for _, x := range list {
+			// Deviating from the spec. See match_test.go for details.
+			if Script(x.script) == t.ScriptID {
+				t.setUndefinedLang(Language(x.lang))
+				return t, nil
+			}
+		}
+	}
+	if t.LangID != 0 {
+		// Search matches for lang-script and lang-region, where lang != und.
+		if t.LangID < langNoIndexOffset {
+			x := likelyLang[t.LangID]
+			if x.flags&isList != 0 {
+				list := likelyLangList[x.region : x.region+uint16(x.script)]
+				if t.ScriptID != 0 {
+					for _, x := range list {
+						if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
+							t.setUndefinedRegion(Region(x.region))
+							return t, nil
+						}
+					}
+				} else if t.RegionID != 0 {
+					count := 0
+					goodScript := true
+					tt := t
+					for _, x := range list {
+						// We visit all entries for which the script was not
+						// defined, including the ones where the region was not
+						// defined. This allows for proper disambiguation within
+						// regions.
+						if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
+							tt.RegionID = Region(x.region)
+							tt.setUndefinedScript(Script(x.script))
+							goodScript = goodScript && tt.ScriptID == Script(x.script)
+							count++
+						}
+					}
+					if count == 1 {
+						return tt, nil
+					}
+					// Even if we fail to find a unique Region, we might have
+					// an unambiguous script.
+					if goodScript {
+						t.ScriptID = tt.ScriptID
+					}
+				}
+			}
+		}
+	} else {
+		// Search matches for und-script.
+		if t.ScriptID != 0 {
+			x := likelyScript[t.ScriptID]
+			if x.region != 0 {
+				t.setUndefinedRegion(Region(x.region))
+				t.setUndefinedLang(Language(x.lang))
+				return t, nil
+			}
+		}
+		// Search matches for und-region. If und-script-region exists, it would
+		// have been found earlier.
+		if t.RegionID != 0 {
+			if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+				x := likelyRegionGroup[i]
+				if x.region != 0 {
+					t.setUndefinedLang(Language(x.lang))
+					t.setUndefinedScript(Script(x.script))
+					t.RegionID = Region(x.region)
+				}
+			} else {
+				x := likelyRegion[t.RegionID]
+				if x.flags&isList != 0 {
+					x = likelyRegionList[x.lang]
+				}
+				if x.script != 0 && x.flags != scriptInFrom {
+					t.setUndefinedLang(Language(x.lang))
+					t.setUndefinedScript(Script(x.script))
+					return t, nil
+				}
+			}
+		}
+	}
+
+	// Search matches for lang.
+	if t.LangID < langNoIndexOffset {
+		x := likelyLang[t.LangID]
+		if x.flags&isList != 0 {
+			x = likelyLangList[x.region]
+		}
+		if x.region != 0 {
+			t.setUndefinedScript(Script(x.script))
+			t.setUndefinedRegion(Region(x.region))
+		}
+		specializeRegion(&t)
+		if t.LangID == 0 {
+			t.LangID = _en // default language
+		}
+		return t, nil
+	}
+	return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+	t.LangID = id.LangID
+	t.ScriptID = id.ScriptID
+	t.RegionID = id.RegionID
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+	t, err := minimizeTags(t)
+	if err != nil {
+		return t, err
+	}
+	t.RemakeString()
+	return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+	if t.equalTags(Und) {
+		return t, nil
+	}
+	max, err := addTags(t)
+	if err != nil {
+		return t, err
+	}
+	for _, id := range [...]Tag{
+		{LangID: t.LangID},
+		{LangID: t.LangID, RegionID: t.RegionID},
+		{LangID: t.LangID, ScriptID: t.ScriptID},
+	} {
+		if x, err := addTags(id); err == nil && max.equalTags(x) {
+			t.setTagsFrom(id)
+			break
+		}
+	}
+	return t, nil
+}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
new file mode 100644
index 0000000..aad1e0a
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/parse.go
@@ -0,0 +1,608 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"bytes"
+	"errors"
+	"fmt"
+	"sort"
+
+	"golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+	return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+	for _, c := range s {
+		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+			return false
+		}
+	}
+	return true
+}
+
+// ErrSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var ErrSyntax = errors.New("language: tag is not well-formed")
+
+// ErrDuplicateKey is returned when a tag contains the same key twice with
+// different values in the -u section.
+var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+	v [8]byte
+}
+
+// NewValueError creates a new ValueError.
+func NewValueError(tag []byte) ValueError {
+	var e ValueError
+	copy(e.v[:], tag)
+	return e
+}
+
+func (e ValueError) tag() []byte {
+	n := bytes.IndexByte(e.v[:], 0)
+	if n == -1 {
+		n = 8
+	}
+	return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+	return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+	b     []byte
+	bytes [max99thPercentileSize]byte
+	token []byte
+	start int // start position of the current token
+	end   int // end position of the current token
+	next  int // next point for scan
+	err   error
+	done  bool
+}
+
+func makeScannerString(s string) scanner {
+	scan := scanner{}
+	if len(s) <= len(scan.bytes) {
+		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+	} else {
+		scan.b = []byte(s)
+	}
+	scan.init()
+	return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+	scan := scanner{b: b}
+	scan.init()
+	return scan
+}
+
+func (s *scanner) init() {
+	for i, c := range s.b {
+		if c == '_' {
+			s.b[i] = '-'
+		}
+	}
+	s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+	for i := start; i < end; i++ {
+		c := s.b[i]
+		if 'A' <= c && c <= 'Z' {
+			s.b[i] += 'a' - 'A'
+		}
+	}
+}
+
+func (s *scanner) setError(e error) {
+	if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
+		s.err = e
+	}
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+	s.start = oldStart
+	if end := oldStart + newSize; end != oldEnd {
+		diff := end - oldEnd
+		var b []byte
+		if n := len(s.b) + diff; n > cap(s.b) {
+			b = make([]byte, n)
+			copy(b, s.b[:oldStart])
+		} else {
+			b = s.b[:n]
+		}
+		copy(b[end:], s.b[oldEnd:])
+		s.b = b
+		s.next = end + (s.next - s.end)
+		s.end = end
+	}
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+	s.resizeRange(s.start, s.end, len(repl))
+	copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+	s.setError(e)
+	if s.start == 0 {
+		s.b = s.b[:+copy(s.b, s.b[s.next:])]
+		s.end = 0
+	} else {
+		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+		s.end = s.start - 1
+	}
+	s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+	diff := end - start
+	s.next -= diff
+	s.start -= diff
+	s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string.  Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+	end = s.end
+	s.token = nil
+	for s.start = s.next; s.next < len(s.b); {
+		i := bytes.IndexByte(s.b[s.next:], '-')
+		if i == -1 {
+			s.end = len(s.b)
+			s.next = len(s.b)
+			i = s.end - s.start
+		} else {
+			s.end = s.next + i
+			s.next = s.end + 1
+		}
+		token := s.b[s.start:s.end]
+		if i < 1 || i > 8 || !isAlphaNum(token) {
+			s.gobble(ErrSyntax)
+			continue
+		}
+		s.token = token
+		return end
+	}
+	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+		s.setError(ErrSyntax)
+		s.b = s.b[:len(s.b)-1]
+	}
+	s.done = true
+	return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+	end = s.end
+	s.scan()
+	for ; len(s.token) >= min; s.scan() {
+		end = s.end
+	}
+	return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+func Parse(s string) (t Tag, err error) {
+	// TODO: consider supporting old-style locale key-value pairs.
+	if s == "" {
+		return Und, ErrSyntax
+	}
+	defer func() {
+		if recover() != nil {
+			t = Und
+			err = ErrSyntax
+			return
+		}
+	}()
+	if len(s) <= maxAltTaglen {
+		b := [maxAltTaglen]byte{}
+		for i, c := range s {
+			// Generating invalid UTF-8 is okay as it won't match.
+			if 'A' <= c && c <= 'Z' {
+				c += 'a' - 'A'
+			} else if c == '_' {
+				c = '-'
+			}
+			b[i] = byte(c)
+		}
+		if t, ok := grandfathered(b); ok {
+			return t, nil
+		}
+	}
+	scan := makeScannerString(s)
+	return parse(&scan, s)
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+	t = Und
+	var end int
+	if n := len(scan.token); n <= 1 {
+		scan.toLower(0, len(scan.b))
+		if n == 0 || scan.token[0] != 'x' {
+			return t, ErrSyntax
+		}
+		end = parseExtensions(scan)
+	} else if n >= 4 {
+		return Und, ErrSyntax
+	} else { // the usual case
+		t, end = parseTag(scan, true)
+		if n := len(scan.token); n == 1 {
+			t.pExt = uint16(end)
+			end = parseExtensions(scan)
+		} else if end < len(scan.b) {
+			scan.setError(ErrSyntax)
+			scan.b = scan.b[:end]
+		}
+	}
+	if int(t.pVariant) < len(scan.b) {
+		if end < len(s) {
+			s = s[:end]
+		}
+		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+			t.str = s
+		} else {
+			t.str = string(scan.b)
+		}
+	} else {
+		t.pVariant, t.pExt = 0, 0
+	}
+	return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+// If doNorm is true, then <lang>-<extlang> will be normalized to <extlang>.
+func parseTag(scan *scanner, doNorm bool) (t Tag, end int) {
+	var e error
+	// TODO: set an error if an unknown lang, script or region is encountered.
+	t.LangID, e = getLangID(scan.token)
+	scan.setError(e)
+	scan.replace(t.LangID.String())
+	langStart := scan.start
+	end = scan.scan()
+	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+		// to a tag of the form <extlang>.
+		if doNorm {
+			lang, e := getLangID(scan.token)
+			if lang != 0 {
+				t.LangID = lang
+				langStr := lang.String()
+				copy(scan.b[langStart:], langStr)
+				scan.b[langStart+len(langStr)] = '-'
+				scan.start = langStart + len(langStr) + 1
+			}
+			scan.gobble(e)
+		}
+		end = scan.scan()
+	}
+	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+		t.ScriptID, e = getScriptID(script, scan.token)
+		if t.ScriptID == 0 {
+			scan.gobble(e)
+		}
+		end = scan.scan()
+	}
+	if n := len(scan.token); n >= 2 && n <= 3 {
+		t.RegionID, e = getRegionID(scan.token)
+		if t.RegionID == 0 {
+			scan.gobble(e)
+		} else {
+			scan.replace(t.RegionID.String())
+		}
+		end = scan.scan()
+	}
+	scan.toLower(scan.start, len(scan.b))
+	t.pVariant = byte(end)
+	end = parseVariants(scan, end, t)
+	t.pExt = uint16(end)
+	return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+	start := scan.start
+	varIDBuf := [4]uint8{}
+	variantBuf := [4][]byte{}
+	varID := varIDBuf[:0]
+	variant := variantBuf[:0]
+	last := -1
+	needSort := false
+	for ; len(scan.token) >= 4; scan.scan() {
+		// TODO: measure the impact of needing this conversion and redesign
+		// the data structure if there is an issue.
+		v, ok := variantIndex[string(scan.token)]
+		if !ok {
+			// unknown variant
+			// TODO: allow user-defined variants?
+			scan.gobble(NewValueError(scan.token))
+			continue
+		}
+		varID = append(varID, v)
+		variant = append(variant, scan.token)
+		if !needSort {
+			if last < int(v) {
+				last = int(v)
+			} else {
+				needSort = true
+				// There is no legal combinations of more than 7 variants
+				// (and this is by no means a useful sequence).
+				const maxVariants = 8
+				if len(varID) > maxVariants {
+					break
+				}
+			}
+		}
+		end = scan.end
+	}
+	if needSort {
+		sort.Sort(variantsSort{varID, variant})
+		k, l := 0, -1
+		for i, v := range varID {
+			w := int(v)
+			if l == w {
+				// Remove duplicates.
+				continue
+			}
+			varID[k] = varID[i]
+			variant[k] = variant[i]
+			k++
+			l = w
+		}
+		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+			end = start - 1
+		} else {
+			scan.resizeRange(start, end, len(str))
+			copy(scan.b[scan.start:], str)
+			end = scan.end
+		}
+	}
+	return end
+}
+
+type variantsSort struct {
+	i []uint8
+	v [][]byte
+}
+
+func (s variantsSort) Len() int {
+	return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+	s.i[i], s.i[j] = s.i[j], s.i[i]
+	s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+	return s.i[i] < s.i[j]
+}
+
+type bytesSort struct {
+	b [][]byte
+	n int // first n bytes to compare
+}
+
+func (b bytesSort) Len() int {
+	return len(b.b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+	b.b[i], b.b[j] = b.b[j], b.b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+	for k := 0; k < b.n; k++ {
+		if b.b[i][k] == b.b[j][k] {
+			continue
+		}
+		return b.b[i][k] < b.b[j][k]
+	}
+	return false
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+	start := scan.start
+	exts := [][]byte{}
+	private := []byte{}
+	end := scan.end
+	for len(scan.token) == 1 {
+		extStart := scan.start
+		ext := scan.token[0]
+		end = parseExtension(scan)
+		extension := scan.b[extStart:end]
+		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+			scan.setError(ErrSyntax)
+			end = extStart
+			continue
+		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+			scan.b = scan.b[:end]
+			return end
+		} else if ext == 'x' {
+			private = extension
+			break
+		}
+		exts = append(exts, extension)
+	}
+	sort.Sort(bytesSort{exts, 1})
+	if len(private) > 0 {
+		exts = append(exts, private)
+	}
+	scan.b = scan.b[:start]
+	if len(exts) > 0 {
+		scan.b = append(scan.b, bytes.Join(exts, separator)...)
+	} else if start > 0 {
+		// Strip trailing '-'.
+		scan.b = scan.b[:start-1]
+	}
+	return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+	start, end := scan.start, scan.end
+	switch scan.token[0] {
+	case 'u': // https://www.ietf.org/rfc/rfc6067.txt
+		attrStart := end
+		scan.scan()
+		for last := []byte{}; len(scan.token) > 2; scan.scan() {
+			if bytes.Compare(scan.token, last) != -1 {
+				// Attributes are unsorted. Start over from scratch.
+				p := attrStart + 1
+				scan.next = p
+				attrs := [][]byte{}
+				for scan.scan(); len(scan.token) > 2; scan.scan() {
+					attrs = append(attrs, scan.token)
+					end = scan.end
+				}
+				sort.Sort(bytesSort{attrs, 3})
+				copy(scan.b[p:], bytes.Join(attrs, separator))
+				break
+			}
+			last = scan.token
+			end = scan.end
+		}
+		// Scan key-type sequences. A key is of length 2 and may be followed
+		// by 0 or more "type" subtags from 3 to the maximum of 8 letters.
+		var last, key []byte
+		for attrEnd := end; len(scan.token) == 2; last = key {
+			key = scan.token
+			end = scan.end
+			for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() {
+				end = scan.end
+			}
+			// TODO: check key value validity
+			if bytes.Compare(key, last) != 1 || scan.err != nil {
+				// We have an invalid key or the keys are not sorted.
+				// Start scanning keys from scratch and reorder.
+				p := attrEnd + 1
+				scan.next = p
+				keys := [][]byte{}
+				for scan.scan(); len(scan.token) == 2; {
+					keyStart := scan.start
+					end = scan.end
+					for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() {
+						end = scan.end
+					}
+					keys = append(keys, scan.b[keyStart:end])
+				}
+				sort.Stable(bytesSort{keys, 2})
+				if n := len(keys); n > 0 {
+					k := 0
+					for i := 1; i < n; i++ {
+						if !bytes.Equal(keys[k][:2], keys[i][:2]) {
+							k++
+							keys[k] = keys[i]
+						} else if !bytes.Equal(keys[k], keys[i]) {
+							scan.setError(ErrDuplicateKey)
+						}
+					}
+					keys = keys[:k+1]
+				}
+				reordered := bytes.Join(keys, separator)
+				if e := p + len(reordered); e < end {
+					scan.deleteRange(e, end)
+					end = e
+				}
+				copy(scan.b[p:], reordered)
+				break
+			}
+		}
+	case 't': // https://www.ietf.org/rfc/rfc6497.txt
+		scan.scan()
+		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+			_, end = parseTag(scan, false)
+			scan.toLower(start, end)
+		}
+		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+			end = scan.acceptMinSize(3)
+		}
+	case 'x':
+		end = scan.acceptMinSize(1)
+	default:
+		end = scan.acceptMinSize(2)
+	}
+	return end
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+	if s[p] == '-' {
+		p++
+	}
+	if s[p] == 'x' {
+		return len(s), s[p:]
+	}
+	end = nextExtension(s, p)
+	return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+	for n := len(s) - 3; p < n; {
+		if s[p] == '-' {
+			if s[p+2] == '-' {
+				return p
+			}
+			p += 3
+		} else {
+			p++
+		}
+	}
+	return len(s)
+}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
new file mode 100644
index 0000000..14167e7
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tables.go
@@ -0,0 +1,3494 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const NumLanguages = 8798
+
+const NumScripts = 261
+
+const NumRegions = 358
+
+type FromTo struct {
+	From uint16
+	To   uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+	_af  = 22
+	_am  = 39
+	_ar  = 58
+	_az  = 88
+	_bg  = 126
+	_bn  = 165
+	_ca  = 215
+	_cs  = 250
+	_da  = 257
+	_de  = 269
+	_el  = 310
+	_en  = 313
+	_es  = 318
+	_et  = 320
+	_fa  = 328
+	_fi  = 337
+	_fil = 339
+	_fr  = 350
+	_gu  = 420
+	_he  = 444
+	_hi  = 446
+	_hr  = 465
+	_hu  = 469
+	_hy  = 471
+	_id  = 481
+	_is  = 504
+	_it  = 505
+	_ja  = 512
+	_ka  = 528
+	_kk  = 578
+	_km  = 586
+	_kn  = 593
+	_ko  = 596
+	_ky  = 650
+	_lo  = 696
+	_lt  = 704
+	_lv  = 711
+	_mk  = 767
+	_ml  = 772
+	_mn  = 779
+	_mo  = 784
+	_mr  = 795
+	_ms  = 799
+	_mul = 806
+	_my  = 817
+	_nb  = 839
+	_ne  = 849
+	_nl  = 871
+	_no  = 879
+	_pa  = 925
+	_pl  = 947
+	_pt  = 960
+	_ro  = 988
+	_ru  = 994
+	_sh  = 1031
+	_si  = 1036
+	_sk  = 1042
+	_sl  = 1046
+	_sq  = 1073
+	_sr  = 1074
+	_sv  = 1092
+	_sw  = 1093
+	_ta  = 1104
+	_te  = 1121
+	_th  = 1131
+	_tl  = 1146
+	_tn  = 1152
+	_tr  = 1162
+	_uk  = 1198
+	_ur  = 1204
+	_uz  = 1212
+	_vi  = 1219
+	_zh  = 1321
+	_zu  = 1327
+	_jbo = 515
+	_ami = 1650
+	_bnn = 2357
+	_hak = 438
+	_tlh = 14467
+	_lb  = 661
+	_nv  = 899
+	_pwn = 12055
+	_tao = 14188
+	_tay = 14198
+	_tsu = 14662
+	_nn  = 874
+	_sfb = 13629
+	_vgt = 15701
+	_sgg = 13660
+	_cmn = 3007
+	_nan = 835
+	_hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+//   - if the first letter of the 2- and 3-letter ISO codes are the same:
+//     the second and third letter of the 3-letter ISO code.
+//   - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+//
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+	// Entry 0 - 3F
+	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72,
+	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a,
+	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+	// Entry 40 - 7F
+	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+	// Entry 80 - BF
+	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff,
+	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+	0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+	// Entry C0 - FF
+	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+	0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56,
+	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef,
+	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35,
+	0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00,
+	0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03,
+	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+	// Entry 100 - 13F
+	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c,
+	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f,
+	0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+	0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb,
+	// Entry 140 - 17F
+	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16,
+	0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06,
+	0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09,
+	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05,
+	0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04,
+	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+	0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03,
+	// Entry 180 - 1BF
+	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+	0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+	// Entry 200 - 23F
+	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+	0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf,
+	0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3,
+	0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d,
+	0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01,
+	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+	// Entry 240 - 27F
+	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+	0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0,
+	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+	0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+	0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+	// Entry 280 - 2BF
+	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+	// Entry 2C0 - 2FF
+	0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2,
+	0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9,
+	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08,
+	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00,
+	// Entry 300 - 33F
+	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+	0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0,
+	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+	// Entry 380 - 3BF
+	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f,
+	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+	// Entry 3C0 - 3FF
+	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20,
+	0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11,
+	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03,
+	0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10,
+	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+	// Entry 400 - 43F
+	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+	// Entry 440 - 47F
+	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd,
+	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+	// Entry 480 - 4BF
+	0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb,
+	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+	0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41,
+	0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05,
+	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05,
+	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+	0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1,
+	// Entry 4C0 - 4FF
+	0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed,
+	0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+	0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7,
+	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+	0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+	// Entry 500 - 53F
+	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+	0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7,
+	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7,
+	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+	// Entry 540 - 57F
+	0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	// Entry 580 - 5BF
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81,
+	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+	// Entry 5C0 - 5FF
+	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02,
+	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+	0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+	0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20,
+	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+	0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe,
+	// Entry 600 - 63F
+	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f,
+	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+	0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18,
+	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+	// Entry 640 - 67F
+	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c,
+	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98,
+	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+	0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4,
+	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+	0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9,
+	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+	// Entry 680 - 6BF
+	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+	0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda,
+	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0,
+	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06,
+	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+	0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f,
+	// Entry 6C0 - 6FF
+	0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08,
+	0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41,
+	0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+	// Entry 700 - 73F
+	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+	0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01,
+	0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 740 - 77F
+	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46,
+	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+	0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75,
+	0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+	// Entry 780 - 7BF
+	0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+	0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0,
+	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+	0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41,
+	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40,
+	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+	// Entry 7C0 - 7FF
+	0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42,
+	0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56,
+	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+	0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01,
+	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+	// Entry 800 - 83F
+	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+	0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1,
+	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+	0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+	// Entry 840 - 87F
+	0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03,
+	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+	0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1,
+	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+	// Entry 880 - 8BF
+	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+	0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// AliasMap maps langIDs to their suggested replacements.
+// Size: 772 bytes, 193 elements
+var AliasMap = [193]FromTo{
+	0:   {From: 0x82, To: 0x88},
+	1:   {From: 0x187, To: 0x1ae},
+	2:   {From: 0x1f3, To: 0x1e1},
+	3:   {From: 0x1fb, To: 0x1bc},
+	4:   {From: 0x208, To: 0x512},
+	5:   {From: 0x20f, To: 0x20e},
+	6:   {From: 0x310, To: 0x3dc},
+	7:   {From: 0x347, To: 0x36f},
+	8:   {From: 0x407, To: 0x432},
+	9:   {From: 0x47a, To: 0x153},
+	10:  {From: 0x490, To: 0x451},
+	11:  {From: 0x4a2, To: 0x21},
+	12:  {From: 0x53e, To: 0x544},
+	13:  {From: 0x58f, To: 0x12d},
+	14:  {From: 0x62b, To: 0x34},
+	15:  {From: 0x62f, To: 0x14},
+	16:  {From: 0x630, To: 0x1eb1},
+	17:  {From: 0x651, To: 0x431},
+	18:  {From: 0x662, To: 0x431},
+	19:  {From: 0x6ed, To: 0x3a},
+	20:  {From: 0x6f8, To: 0x1d7},
+	21:  {From: 0x709, To: 0x3625},
+	22:  {From: 0x73e, To: 0x21a1},
+	23:  {From: 0x7b3, To: 0x56},
+	24:  {From: 0x7b9, To: 0x299b},
+	25:  {From: 0x7c5, To: 0x58},
+	26:  {From: 0x7e6, To: 0x145},
+	27:  {From: 0x80c, To: 0x5a},
+	28:  {From: 0x815, To: 0x8d},
+	29:  {From: 0x87e, To: 0x810},
+	30:  {From: 0x8a8, To: 0x8b7},
+	31:  {From: 0x8c3, To: 0xee3},
+	32:  {From: 0x8fa, To: 0x1dc},
+	33:  {From: 0x9ef, To: 0x331},
+	34:  {From: 0xa36, To: 0x2c5},
+	35:  {From: 0xa3d, To: 0xbf},
+	36:  {From: 0xabe, To: 0x3322},
+	37:  {From: 0xb38, To: 0x529},
+	38:  {From: 0xb75, To: 0x265a},
+	39:  {From: 0xb7e, To: 0xbc3},
+	40:  {From: 0xb9b, To: 0x44e},
+	41:  {From: 0xbbc, To: 0x4229},
+	42:  {From: 0xbbf, To: 0x529},
+	43:  {From: 0xbfe, To: 0x2da7},
+	44:  {From: 0xc2e, To: 0x3181},
+	45:  {From: 0xcb9, To: 0xf3},
+	46:  {From: 0xd08, To: 0xfa},
+	47:  {From: 0xdc8, To: 0x11a},
+	48:  {From: 0xdd7, To: 0x32d},
+	49:  {From: 0xdf8, To: 0xdfb},
+	50:  {From: 0xdfe, To: 0x531},
+	51:  {From: 0xe01, To: 0xdf3},
+	52:  {From: 0xedf, To: 0x205a},
+	53:  {From: 0xee9, To: 0x222e},
+	54:  {From: 0xeee, To: 0x2e9a},
+	55:  {From: 0xf39, To: 0x367},
+	56:  {From: 0x10d0, To: 0x140},
+	57:  {From: 0x1104, To: 0x2d0},
+	58:  {From: 0x11a0, To: 0x1ec},
+	59:  {From: 0x1279, To: 0x21},
+	60:  {From: 0x1424, To: 0x15e},
+	61:  {From: 0x1470, To: 0x14e},
+	62:  {From: 0x151f, To: 0xd9b},
+	63:  {From: 0x1523, To: 0x390},
+	64:  {From: 0x1532, To: 0x19f},
+	65:  {From: 0x1580, To: 0x210},
+	66:  {From: 0x1583, To: 0x10d},
+	67:  {From: 0x15a3, To: 0x3caf},
+	68:  {From: 0x1630, To: 0x222e},
+	69:  {From: 0x166a, To: 0x19b},
+	70:  {From: 0x16c8, To: 0x136},
+	71:  {From: 0x1700, To: 0x29f8},
+	72:  {From: 0x1718, To: 0x194},
+	73:  {From: 0x1727, To: 0xf3f},
+	74:  {From: 0x177a, To: 0x178},
+	75:  {From: 0x1809, To: 0x17b6},
+	76:  {From: 0x1816, To: 0x18f3},
+	77:  {From: 0x188a, To: 0x436},
+	78:  {From: 0x1979, To: 0x1d01},
+	79:  {From: 0x1a74, To: 0x2bb0},
+	80:  {From: 0x1a8a, To: 0x1f8},
+	81:  {From: 0x1b5a, To: 0x1fa},
+	82:  {From: 0x1b86, To: 0x1515},
+	83:  {From: 0x1d64, To: 0x2c9b},
+	84:  {From: 0x2038, To: 0x37b1},
+	85:  {From: 0x203d, To: 0x20dd},
+	86:  {From: 0x2042, To: 0x2e00},
+	87:  {From: 0x205a, To: 0x30b},
+	88:  {From: 0x20e3, To: 0x274},
+	89:  {From: 0x20ee, To: 0x263},
+	90:  {From: 0x20f2, To: 0x22d},
+	91:  {From: 0x20f9, To: 0x256},
+	92:  {From: 0x210f, To: 0x21eb},
+	93:  {From: 0x2135, To: 0x27d},
+	94:  {From: 0x2160, To: 0x913},
+	95:  {From: 0x2199, To: 0x121},
+	96:  {From: 0x21ce, To: 0x1561},
+	97:  {From: 0x21e6, To: 0x504},
+	98:  {From: 0x21f4, To: 0x49f},
+	99:  {From: 0x21fb, To: 0x269},
+	100: {From: 0x222d, To: 0x121},
+	101: {From: 0x2237, To: 0x121},
+	102: {From: 0x2248, To: 0x217d},
+	103: {From: 0x2262, To: 0x92a},
+	104: {From: 0x2316, To: 0x3226},
+	105: {From: 0x236a, To: 0x2835},
+	106: {From: 0x2382, To: 0x3365},
+	107: {From: 0x2472, To: 0x2c7},
+	108: {From: 0x24e4, To: 0x2ff},
+	109: {From: 0x24f0, To: 0x2fa},
+	110: {From: 0x24fa, To: 0x31f},
+	111: {From: 0x2550, To: 0xb5b},
+	112: {From: 0x25a9, To: 0xe2},
+	113: {From: 0x263e, To: 0x2d0},
+	114: {From: 0x26c9, To: 0x26b4},
+	115: {From: 0x26f9, To: 0x3c8},
+	116: {From: 0x2727, To: 0x3caf},
+	117: {From: 0x2755, To: 0x6a4},
+	118: {From: 0x2765, To: 0x26b4},
+	119: {From: 0x2789, To: 0x4358},
+	120: {From: 0x27c9, To: 0x2001},
+	121: {From: 0x28ea, To: 0x27b1},
+	122: {From: 0x28ef, To: 0x2837},
+	123: {From: 0x28fe, To: 0xaa5},
+	124: {From: 0x2914, To: 0x351},
+	125: {From: 0x2986, To: 0x2da7},
+	126: {From: 0x29f0, To: 0x96b},
+	127: {From: 0x2b1a, To: 0x38d},
+	128: {From: 0x2bfc, To: 0x395},
+	129: {From: 0x2c3f, To: 0x3caf},
+	130: {From: 0x2ce1, To: 0x2201},
+	131: {From: 0x2cfc, To: 0x3be},
+	132: {From: 0x2d13, To: 0x597},
+	133: {From: 0x2d47, To: 0x148},
+	134: {From: 0x2d48, To: 0x148},
+	135: {From: 0x2dff, To: 0x2f1},
+	136: {From: 0x2e08, To: 0x19cc},
+	137: {From: 0x2e10, To: 0xc45},
+	138: {From: 0x2e1a, To: 0x2d95},
+	139: {From: 0x2e21, To: 0x292},
+	140: {From: 0x2e54, To: 0x7d},
+	141: {From: 0x2e65, To: 0x2282},
+	142: {From: 0x2e97, To: 0x1a4},
+	143: {From: 0x2ea0, To: 0x2e9b},
+	144: {From: 0x2eef, To: 0x2ed7},
+	145: {From: 0x3193, To: 0x3c4},
+	146: {From: 0x3366, To: 0x338e},
+	147: {From: 0x342a, To: 0x3dc},
+	148: {From: 0x34ee, To: 0x18d0},
+	149: {From: 0x35c8, To: 0x2c9b},
+	150: {From: 0x35e6, To: 0x412},
+	151: {From: 0x35f5, To: 0x24b},
+	152: {From: 0x360d, To: 0x1dc},
+	153: {From: 0x3658, To: 0x246},
+	154: {From: 0x3676, To: 0x3f4},
+	155: {From: 0x36fd, To: 0x445},
+	156: {From: 0x3747, To: 0x3b42},
+	157: {From: 0x37c0, To: 0x121},
+	158: {From: 0x3816, To: 0x38f2},
+	159: {From: 0x382a, To: 0x2b48},
+	160: {From: 0x382b, To: 0x2c9b},
+	161: {From: 0x382f, To: 0xa9},
+	162: {From: 0x3832, To: 0x3228},
+	163: {From: 0x386c, To: 0x39a6},
+	164: {From: 0x3892, To: 0x3fc0},
+	165: {From: 0x38a0, To: 0x45f},
+	166: {From: 0x38a5, To: 0x39d7},
+	167: {From: 0x38b4, To: 0x1fa4},
+	168: {From: 0x38b5, To: 0x2e9a},
+	169: {From: 0x38fa, To: 0x38f1},
+	170: {From: 0x395c, To: 0x47e},
+	171: {From: 0x3b4e, To: 0xd91},
+	172: {From: 0x3b78, To: 0x137},
+	173: {From: 0x3c99, To: 0x4bc},
+	174: {From: 0x3fbd, To: 0x100},
+	175: {From: 0x4208, To: 0xa91},
+	176: {From: 0x42be, To: 0x573},
+	177: {From: 0x42f9, To: 0x3f60},
+	178: {From: 0x4378, To: 0x25a},
+	179: {From: 0x43b8, To: 0xe6c},
+	180: {From: 0x43cd, To: 0x10f},
+	181: {From: 0x43d4, To: 0x4848},
+	182: {From: 0x44af, To: 0x3322},
+	183: {From: 0x44e3, To: 0x512},
+	184: {From: 0x45ca, To: 0x2409},
+	185: {From: 0x45dd, To: 0x26dc},
+	186: {From: 0x4610, To: 0x48ae},
+	187: {From: 0x46ae, To: 0x46a0},
+	188: {From: 0x473e, To: 0x4745},
+	189: {From: 0x4817, To: 0x3503},
+	190: {From: 0x483b, To: 0x208b},
+	191: {From: 0x4916, To: 0x31f},
+	192: {From: 0x49a7, To: 0x523},
+}
+
+// Size: 193 bytes, 193 elements
+var AliasTypes = [193]AliasType{
+	// Entry 0 - 3F
+	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0,
+	1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0,
+	0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1,
+	1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1,
+	// Entry 40 - 7F
+	1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0,
+	2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0,
+	0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0,
+	1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+	// Entry 80 - BF
+	1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0,
+	0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0,
+	0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0,
+	0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1,
+	// Entry C0 - FF
+	1,
+}
+
+const (
+	_Latn = 91
+	_Hani = 57
+	_Hans = 59
+	_Hant = 60
+	_Qaaa = 149
+	_Qaai = 157
+	_Qabx = 198
+	_Zinh = 255
+	_Zyyy = 260
+	_Zzzz = 261
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 1052 bytes
+	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+	"BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" +
+	"DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" +
+	"GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" +
+	"JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" +
+	"LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" +
+	"MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" +
+	"NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" +
+	"PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" +
+	"QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" +
+	"QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" +
+	"QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" +
+	"SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" +
+	"TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" +
+	"YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists.  If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 40 - 7F
+	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00,
+	// Entry 80 - BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry C0 - FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 100 - 13F
+	0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00,
+	// Entry 140 - 17F
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 180 - 1BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00,
+	// Entry 200 - 23F
+	0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 240 - 27F
+	0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00,
+	0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 280 - 2BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+	0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 2C0 - 2FF
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20,
+	// Entry 300 - 33F
+	0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 380 - 3BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+	// Entry 3C0 - 3FF
+	0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 400 - 43F
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+	// Entry 440 - 47F
+	0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	// Entry 480 - 4BF
+	0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 4C0 - 4FF
+	0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 500 - 53F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00,
+}
+
+const (
+	_001 = 1
+	_419 = 31
+	_BR  = 65
+	_CA  = 73
+	_ES  = 111
+	_GB  = 124
+	_MD  = 189
+	_PT  = 239
+	_UK  = 307
+	_US  = 310
+	_ZZ  = 358
+	_XA  = 324
+	_XC  = 326
+	_XK  = 334
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 359 bytes, 359 elements
+var regionTypes = [359]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 40 - 7F
+	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06,
+	0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 80 - BF
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry C0 - FF
+	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04,
+	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	// Entry 100 - 13F
+	0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	// Entry 140 - 17F
+	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06,
+	0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+//   - [A-Z}{2}: the first letter of the 2-letter code plus these two
+//     letters form the 3-letter ISO code.
+//   - 0, n:     index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1312 bytes
+	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+	"CQ  CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" +
+	"OMDYHYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSM" +
+	"FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" +
+	"NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERL" +
+	"ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" +
+	"\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" +
+	"LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" +
+	"MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" +
+	"NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" +
+	"\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" +
+	"QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" +
+	"SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" +
+	"SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" +
+	"TOTVUVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" +
+	"NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" +
+	"NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" +
+	"ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+	0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106,
+	0x0122, 0x0160, 0x00dd,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]FromTo{
+	0:  {From: 0x44, To: 0xc5},
+	1:  {From: 0x59, To: 0xa8},
+	2:  {From: 0x60, To: 0x61},
+	3:  {From: 0x67, To: 0x3b},
+	4:  {From: 0x7a, To: 0x79},
+	5:  {From: 0x94, To: 0x37},
+	6:  {From: 0xa4, To: 0x134},
+	7:  {From: 0xc2, To: 0x134},
+	8:  {From: 0xd8, To: 0x140},
+	9:  {From: 0xdd, To: 0x2b},
+	10: {From: 0xf0, To: 0x134},
+	11: {From: 0xf3, To: 0xe3},
+	12: {From: 0xfd, To: 0x71},
+	13: {From: 0x104, To: 0x165},
+	14: {From: 0x12b, To: 0x127},
+	15: {From: 0x133, To: 0x7c},
+	16: {From: 0x13b, To: 0x13f},
+	17: {From: 0x142, To: 0x134},
+	18: {From: 0x15e, To: 0x15f},
+	19: {From: 0x164, To: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 718 bytes, 359 elements
+var m49 = [359]int16{
+	// Entry 0 - 3F
+	0, 1, 2, 3, 5, 9, 11, 13,
+	14, 15, 17, 18, 19, 21, 29, 30,
+	34, 35, 39, 53, 54, 57, 61, 142,
+	143, 145, 150, 151, 154, 155, 202, 419,
+	958, 0, 20, 784, 4, 28, 660, 8,
+	51, 530, 24, 10, 32, 16, 40, 36,
+	533, 248, 31, 70, 52, 50, 56, 854,
+	100, 48, 108, 204, 652, 60, 96, 68,
+	// Entry 40 - 7F
+	535, 76, 44, 64, 104, 74, 72, 112,
+	84, 124, 166, 180, 140, 178, 756, 384,
+	184, 152, 120, 156, 170, 0, 0, 188,
+	891, 296, 192, 132, 531, 162, 196, 203,
+	278, 276, 0, 262, 208, 212, 214, 204,
+	12, 0, 218, 233, 818, 732, 232, 724,
+	231, 967, 0, 246, 242, 238, 583, 234,
+	0, 250, 249, 266, 826, 308, 268, 254,
+	// Entry 80 - BF
+	831, 288, 292, 304, 270, 324, 312, 226,
+	300, 239, 320, 316, 624, 328, 344, 334,
+	340, 191, 332, 348, 854, 0, 360, 372,
+	376, 833, 356, 86, 368, 364, 352, 380,
+	832, 388, 400, 392, 581, 404, 417, 116,
+	296, 174, 659, 408, 410, 414, 136, 398,
+	418, 422, 662, 438, 144, 430, 426, 440,
+	442, 428, 434, 504, 492, 498, 499, 663,
+	// Entry C0 - FF
+	450, 584, 581, 807, 466, 104, 496, 446,
+	580, 474, 478, 500, 470, 480, 462, 454,
+	484, 458, 508, 516, 540, 562, 574, 566,
+	548, 558, 528, 578, 524, 10, 520, 536,
+	570, 554, 512, 591, 0, 604, 258, 598,
+	608, 586, 616, 666, 612, 630, 275, 620,
+	581, 585, 600, 591, 634, 959, 960, 961,
+	962, 963, 964, 965, 966, 967, 968, 969,
+	// Entry 100 - 13F
+	970, 971, 972, 638, 716, 642, 688, 643,
+	646, 682, 90, 690, 729, 752, 702, 654,
+	705, 744, 703, 694, 674, 686, 706, 740,
+	728, 678, 810, 222, 534, 760, 748, 0,
+	796, 148, 260, 768, 764, 762, 772, 626,
+	795, 788, 776, 626, 792, 780, 798, 158,
+	834, 804, 800, 826, 581, 0, 840, 858,
+	860, 336, 670, 704, 862, 92, 850, 704,
+	// Entry 140 - 17F
+	548, 876, 581, 882, 973, 974, 975, 976,
+	977, 978, 979, 980, 981, 982, 983, 984,
+	985, 986, 987, 988, 989, 990, 991, 992,
+	993, 994, 995, 996, 997, 998, 720, 887,
+	175, 891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+//
+//	fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+//
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+	0, 59, 108, 143, 181, 220, 259, 291,
+	333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+	// Entry 0 - 3F
+	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+	0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+	0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047,
+	0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18,
+	// Entry 40 - 7F
+	0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+	0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d,
+	0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f,
+	0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70,
+	0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73,
+	0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b,
+	0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882,
+	0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885,
+	// Entry 80 - BF
+	0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e,
+	0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f,
+	0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad,
+	0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba,
+	0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce,
+	0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6,
+	0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de,
+	0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df,
+	// Entry C0 - FF
+	0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6,
+	0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3,
+	0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c,
+	0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c,
+	0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514,
+	0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12,
+	0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118,
+	0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e,
+	// Entry 100 - 13F
+	0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023,
+	0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3,
+	0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136,
+	0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f,
+	0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8,
+	0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500,
+	0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549,
+	0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551,
+	// Entry 140 - 17F
+	0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559,
+	0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66,
+}
+
+// Size: 2128 bytes
+var variantIndex = map[string]uint8{
+	"1606nict": 0x0,
+	"1694acad": 0x1,
+	"1901":     0x2,
+	"1959acad": 0x3,
+	"1994":     0x67,
+	"1996":     0x4,
+	"abl1943":  0x5,
+	"akuapem":  0x6,
+	"alalc97":  0x69,
+	"aluku":    0x7,
+	"ao1990":   0x8,
+	"aranes":   0x9,
+	"arevela":  0xa,
+	"arevmda":  0xb,
+	"arkaika":  0xc,
+	"asante":   0xd,
+	"auvern":   0xe,
+	"baku1926": 0xf,
+	"balanka":  0x10,
+	"barla":    0x11,
+	"basiceng": 0x12,
+	"bauddha":  0x13,
+	"bciav":    0x14,
+	"bcizbl":   0x15,
+	"biscayan": 0x16,
+	"biske":    0x62,
+	"bohoric":  0x17,
+	"boont":    0x18,
+	"bornholm": 0x19,
+	"cisaup":   0x1a,
+	"colb1945": 0x1b,
+	"cornu":    0x1c,
+	"creiss":   0x1d,
+	"dajnko":   0x1e,
+	"ekavsk":   0x1f,
+	"emodeng":  0x20,
+	"fonipa":   0x6a,
+	"fonkirsh": 0x6b,
+	"fonnapa":  0x6c,
+	"fonupa":   0x6d,
+	"fonxsamp": 0x6e,
+	"gallo":    0x21,
+	"gascon":   0x22,
+	"grclass":  0x23,
+	"grital":   0x24,
+	"grmistr":  0x25,
+	"hepburn":  0x26,
+	"heploc":   0x68,
+	"hognorsk": 0x27,
+	"hsistemo": 0x28,
+	"ijekavsk": 0x29,
+	"itihasa":  0x2a,
+	"ivanchov": 0x2b,
+	"jauer":    0x2c,
+	"jyutping": 0x2d,
+	"kkcor":    0x2e,
+	"kociewie": 0x2f,
+	"kscor":    0x30,
+	"laukika":  0x31,
+	"lemosin":  0x32,
+	"lengadoc": 0x33,
+	"lipaw":    0x63,
+	"ltg1929":  0x34,
+	"ltg2007":  0x35,
+	"luna1918": 0x36,
+	"metelko":  0x37,
+	"monoton":  0x38,
+	"ndyuka":   0x39,
+	"nedis":    0x3a,
+	"newfound": 0x3b,
+	"nicard":   0x3c,
+	"njiva":    0x64,
+	"nulik":    0x3d,
+	"osojs":    0x65,
+	"oxendict": 0x3e,
+	"pahawh2":  0x3f,
+	"pahawh3":  0x40,
+	"pahawh4":  0x41,
+	"pamaka":   0x42,
+	"peano":    0x43,
+	"petr1708": 0x44,
+	"pinyin":   0x45,
+	"polyton":  0x46,
+	"provenc":  0x47,
+	"puter":    0x48,
+	"rigik":    0x49,
+	"rozaj":    0x4a,
+	"rumgr":    0x4b,
+	"scotland": 0x4c,
+	"scouse":   0x4d,
+	"simple":   0x6f,
+	"solba":    0x66,
+	"sotav":    0x4e,
+	"spanglis": 0x4f,
+	"surmiran": 0x50,
+	"sursilv":  0x51,
+	"sutsilv":  0x52,
+	"synnejyl": 0x53,
+	"tarask":   0x54,
+	"tongyong": 0x55,
+	"tunumiit": 0x56,
+	"uccor":    0x57,
+	"ucrcor":   0x58,
+	"ulster":   0x59,
+	"unifon":   0x5a,
+	"vaidika":  0x5b,
+	"valencia": 0x5c,
+	"vallader": 0x5d,
+	"vecdruka": 0x5e,
+	"vivaraup": 0x5f,
+	"wadegile": 0x60,
+	"xsistemo": 0x61,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 105
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+	lang   uint16
+	region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 1052 bytes, 263 elements
+var likelyScript = [263]likelyLangRegion{
+	1:   {lang: 0x14e, region: 0x85},
+	3:   {lang: 0x2a2, region: 0x107},
+	4:   {lang: 0x1f, region: 0x9a},
+	5:   {lang: 0x3a, region: 0x6c},
+	7:   {lang: 0x3b, region: 0x9d},
+	8:   {lang: 0x1d7, region: 0x28},
+	9:   {lang: 0x13, region: 0x9d},
+	10:  {lang: 0x5b, region: 0x96},
+	11:  {lang: 0x60, region: 0x52},
+	12:  {lang: 0xb9, region: 0xb5},
+	13:  {lang: 0x63, region: 0x96},
+	14:  {lang: 0xa5, region: 0x35},
+	15:  {lang: 0x3e9, region: 0x9a},
+	17:  {lang: 0x529, region: 0x12f},
+	18:  {lang: 0x3b1, region: 0x9a},
+	19:  {lang: 0x15e, region: 0x79},
+	20:  {lang: 0xc2, region: 0x96},
+	21:  {lang: 0x9d, region: 0xe8},
+	22:  {lang: 0xdb, region: 0x35},
+	23:  {lang: 0xf3, region: 0x49},
+	24:  {lang: 0x4f0, region: 0x12c},
+	25:  {lang: 0xe7, region: 0x13f},
+	26:  {lang: 0xe5, region: 0x136},
+	29:  {lang: 0xf1, region: 0x6c},
+	31:  {lang: 0x1a0, region: 0x5e},
+	32:  {lang: 0x3e2, region: 0x107},
+	34:  {lang: 0x1be, region: 0x9a},
+	38:  {lang: 0x15e, region: 0x79},
+	41:  {lang: 0x133, region: 0x6c},
+	42:  {lang: 0x431, region: 0x27},
+	44:  {lang: 0x27, region: 0x70},
+	46:  {lang: 0x210, region: 0x7e},
+	47:  {lang: 0xfe, region: 0x38},
+	49:  {lang: 0x19b, region: 0x9a},
+	50:  {lang: 0x19e, region: 0x131},
+	51:  {lang: 0x3e9, region: 0x9a},
+	52:  {lang: 0x136, region: 0x88},
+	53:  {lang: 0x1a4, region: 0x9a},
+	54:  {lang: 0x39d, region: 0x9a},
+	55:  {lang: 0x529, region: 0x12f},
+	56:  {lang: 0x254, region: 0xac},
+	57:  {lang: 0x529, region: 0x53},
+	58:  {lang: 0x1cb, region: 0xe8},
+	59:  {lang: 0x529, region: 0x53},
+	60:  {lang: 0x529, region: 0x12f},
+	61:  {lang: 0x2fd, region: 0x9c},
+	62:  {lang: 0x1bc, region: 0x98},
+	63:  {lang: 0x200, region: 0xa3},
+	64:  {lang: 0x1c5, region: 0x12c},
+	65:  {lang: 0x1ca, region: 0xb0},
+	68:  {lang: 0x1d5, region: 0x93},
+	70:  {lang: 0x142, region: 0x9f},
+	71:  {lang: 0x254, region: 0xac},
+	72:  {lang: 0x20e, region: 0x96},
+	73:  {lang: 0x200, region: 0xa3},
+	75:  {lang: 0x135, region: 0xc5},
+	76:  {lang: 0x200, region: 0xa3},
+	78:  {lang: 0x3bb, region: 0xe9},
+	79:  {lang: 0x24a, region: 0xa7},
+	80:  {lang: 0x3fa, region: 0x9a},
+	83:  {lang: 0x251, region: 0x9a},
+	84:  {lang: 0x254, region: 0xac},
+	86:  {lang: 0x88, region: 0x9a},
+	87:  {lang: 0x370, region: 0x124},
+	88:  {lang: 0x2b8, region: 0xb0},
+	93:  {lang: 0x29f, region: 0x9a},
+	94:  {lang: 0x2a8, region: 0x9a},
+	95:  {lang: 0x28f, region: 0x88},
+	96:  {lang: 0x1a0, region: 0x88},
+	97:  {lang: 0x2ac, region: 0x53},
+	99:  {lang: 0x4f4, region: 0x12c},
+	100: {lang: 0x4f5, region: 0x12c},
+	101: {lang: 0x1be, region: 0x9a},
+	103: {lang: 0x337, region: 0x9d},
+	104: {lang: 0x4f7, region: 0x53},
+	105: {lang: 0xa9, region: 0x53},
+	108: {lang: 0x2e8, region: 0x113},
+	109: {lang: 0x4f8, region: 0x10c},
+	110: {lang: 0x4f8, region: 0x10c},
+	111: {lang: 0x304, region: 0x9a},
+	112: {lang: 0x31b, region: 0x9a},
+	113: {lang: 0x30b, region: 0x53},
+	115: {lang: 0x31e, region: 0x35},
+	116: {lang: 0x30e, region: 0x9a},
+	117: {lang: 0x414, region: 0xe9},
+	118: {lang: 0x331, region: 0xc5},
+	121: {lang: 0x4f9, region: 0x109},
+	122: {lang: 0x3b, region: 0xa2},
+	123: {lang: 0x353, region: 0xdc},
+	126: {lang: 0x2d0, region: 0x85},
+	127: {lang: 0x52a, region: 0x53},
+	128: {lang: 0x403, region: 0x97},
+	129: {lang: 0x3ee, region: 0x9a},
+	130: {lang: 0x39b, region: 0xc6},
+	131: {lang: 0x395, region: 0x9a},
+	132: {lang: 0x399, region: 0x136},
+	133: {lang: 0x429, region: 0x116},
+	135: {lang: 0x3b, region: 0x11d},
+	136: {lang: 0xfd, region: 0xc5},
+	139: {lang: 0x27d, region: 0x107},
+	140: {lang: 0x2c9, region: 0x53},
+	141: {lang: 0x39f, region: 0x9d},
+	142: {lang: 0x39f, region: 0x53},
+	144: {lang: 0x3ad, region: 0xb1},
+	146: {lang: 0x1c6, region: 0x53},
+	147: {lang: 0x4fd, region: 0x9d},
+	200: {lang: 0x3cb, region: 0x96},
+	203: {lang: 0x372, region: 0x10d},
+	204: {lang: 0x420, region: 0x98},
+	206: {lang: 0x4ff, region: 0x15f},
+	207: {lang: 0x3f0, region: 0x9a},
+	208: {lang: 0x45, region: 0x136},
+	209: {lang: 0x139, region: 0x7c},
+	210: {lang: 0x3e9, region: 0x9a},
+	212: {lang: 0x3e9, region: 0x9a},
+	213: {lang: 0x3fa, region: 0x9a},
+	214: {lang: 0x40c, region: 0xb4},
+	217: {lang: 0x433, region: 0x9a},
+	218: {lang: 0xef, region: 0xc6},
+	219: {lang: 0x43e, region: 0x96},
+	221: {lang: 0x44d, region: 0x35},
+	222: {lang: 0x44e, region: 0x9c},
+	226: {lang: 0x45a, region: 0xe8},
+	227: {lang: 0x11a, region: 0x9a},
+	228: {lang: 0x45e, region: 0x53},
+	229: {lang: 0x232, region: 0x53},
+	230: {lang: 0x450, region: 0x9a},
+	231: {lang: 0x4a5, region: 0x53},
+	232: {lang: 0x9f, region: 0x13f},
+	233: {lang: 0x461, region: 0x9a},
+	235: {lang: 0x528, region: 0xbb},
+	236: {lang: 0x153, region: 0xe8},
+	237: {lang: 0x128, region: 0xce},
+	238: {lang: 0x46b, region: 0x124},
+	239: {lang: 0xa9, region: 0x53},
+	240: {lang: 0x2ce, region: 0x9a},
+	243: {lang: 0x4ad, region: 0x11d},
+	244: {lang: 0x4be, region: 0xb5},
+	247: {lang: 0x1ce, region: 0x9a},
+	250: {lang: 0x3a9, region: 0x9d},
+	251: {lang: 0x22, region: 0x9c},
+	253: {lang: 0x1ea, region: 0x53},
+	254: {lang: 0xef, region: 0xc6},
+}
+
+type likelyScriptRegion struct {
+	region uint16
+	script uint16
+	flags  uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 7980 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+	0:    {region: 0x136, script: 0x5b, flags: 0x0},
+	1:    {region: 0x70, script: 0x5b, flags: 0x0},
+	2:    {region: 0x166, script: 0x5b, flags: 0x0},
+	3:    {region: 0x166, script: 0x5b, flags: 0x0},
+	4:    {region: 0x166, script: 0x5b, flags: 0x0},
+	5:    {region: 0x7e, script: 0x20, flags: 0x0},
+	6:    {region: 0x166, script: 0x5b, flags: 0x0},
+	7:    {region: 0x166, script: 0x20, flags: 0x0},
+	8:    {region: 0x81, script: 0x5b, flags: 0x0},
+	9:    {region: 0x166, script: 0x5b, flags: 0x0},
+	10:   {region: 0x166, script: 0x5b, flags: 0x0},
+	11:   {region: 0x166, script: 0x5b, flags: 0x0},
+	12:   {region: 0x96, script: 0x5b, flags: 0x0},
+	13:   {region: 0x132, script: 0x5b, flags: 0x0},
+	14:   {region: 0x81, script: 0x5b, flags: 0x0},
+	15:   {region: 0x166, script: 0x5b, flags: 0x0},
+	16:   {region: 0x166, script: 0x5b, flags: 0x0},
+	17:   {region: 0x107, script: 0x20, flags: 0x0},
+	18:   {region: 0x166, script: 0x5b, flags: 0x0},
+	19:   {region: 0x9d, script: 0x9, flags: 0x0},
+	20:   {region: 0x129, script: 0x5, flags: 0x0},
+	21:   {region: 0x166, script: 0x5b, flags: 0x0},
+	22:   {region: 0x162, script: 0x5b, flags: 0x0},
+	23:   {region: 0x166, script: 0x5b, flags: 0x0},
+	24:   {region: 0x166, script: 0x5b, flags: 0x0},
+	25:   {region: 0x166, script: 0x5b, flags: 0x0},
+	26:   {region: 0x166, script: 0x5b, flags: 0x0},
+	27:   {region: 0x166, script: 0x5b, flags: 0x0},
+	28:   {region: 0x52, script: 0x5b, flags: 0x0},
+	29:   {region: 0x166, script: 0x5b, flags: 0x0},
+	30:   {region: 0x166, script: 0x5b, flags: 0x0},
+	31:   {region: 0x9a, script: 0x4, flags: 0x0},
+	32:   {region: 0x166, script: 0x5b, flags: 0x0},
+	33:   {region: 0x81, script: 0x5b, flags: 0x0},
+	34:   {region: 0x9c, script: 0xfb, flags: 0x0},
+	35:   {region: 0x166, script: 0x5b, flags: 0x0},
+	36:   {region: 0x166, script: 0x5b, flags: 0x0},
+	37:   {region: 0x14e, script: 0x5b, flags: 0x0},
+	38:   {region: 0x107, script: 0x20, flags: 0x0},
+	39:   {region: 0x70, script: 0x2c, flags: 0x0},
+	40:   {region: 0x166, script: 0x5b, flags: 0x0},
+	41:   {region: 0x166, script: 0x5b, flags: 0x0},
+	42:   {region: 0xd7, script: 0x5b, flags: 0x0},
+	43:   {region: 0x166, script: 0x5b, flags: 0x0},
+	45:   {region: 0x166, script: 0x5b, flags: 0x0},
+	46:   {region: 0x166, script: 0x5b, flags: 0x0},
+	47:   {region: 0x166, script: 0x5b, flags: 0x0},
+	48:   {region: 0x166, script: 0x5b, flags: 0x0},
+	49:   {region: 0x166, script: 0x5b, flags: 0x0},
+	50:   {region: 0x166, script: 0x5b, flags: 0x0},
+	51:   {region: 0x96, script: 0x5b, flags: 0x0},
+	52:   {region: 0x166, script: 0x5, flags: 0x0},
+	53:   {region: 0x123, script: 0x5, flags: 0x0},
+	54:   {region: 0x166, script: 0x5b, flags: 0x0},
+	55:   {region: 0x166, script: 0x5b, flags: 0x0},
+	56:   {region: 0x166, script: 0x5b, flags: 0x0},
+	57:   {region: 0x166, script: 0x5b, flags: 0x0},
+	58:   {region: 0x6c, script: 0x5, flags: 0x0},
+	59:   {region: 0x0, script: 0x3, flags: 0x1},
+	60:   {region: 0x166, script: 0x5b, flags: 0x0},
+	61:   {region: 0x51, script: 0x5b, flags: 0x0},
+	62:   {region: 0x3f, script: 0x5b, flags: 0x0},
+	63:   {region: 0x68, script: 0x5, flags: 0x0},
+	65:   {region: 0xbb, script: 0x5, flags: 0x0},
+	66:   {region: 0x6c, script: 0x5, flags: 0x0},
+	67:   {region: 0x9a, script: 0xe, flags: 0x0},
+	68:   {region: 0x130, script: 0x5b, flags: 0x0},
+	69:   {region: 0x136, script: 0xd0, flags: 0x0},
+	70:   {region: 0x166, script: 0x5b, flags: 0x0},
+	71:   {region: 0x166, script: 0x5b, flags: 0x0},
+	72:   {region: 0x6f, script: 0x5b, flags: 0x0},
+	73:   {region: 0x166, script: 0x5b, flags: 0x0},
+	74:   {region: 0x166, script: 0x5b, flags: 0x0},
+	75:   {region: 0x49, script: 0x5b, flags: 0x0},
+	76:   {region: 0x166, script: 0x5b, flags: 0x0},
+	77:   {region: 0x107, script: 0x20, flags: 0x0},
+	78:   {region: 0x166, script: 0x5, flags: 0x0},
+	79:   {region: 0x166, script: 0x5b, flags: 0x0},
+	80:   {region: 0x166, script: 0x5b, flags: 0x0},
+	81:   {region: 0x166, script: 0x5b, flags: 0x0},
+	82:   {region: 0x9a, script: 0x22, flags: 0x0},
+	83:   {region: 0x166, script: 0x5b, flags: 0x0},
+	84:   {region: 0x166, script: 0x5b, flags: 0x0},
+	85:   {region: 0x166, script: 0x5b, flags: 0x0},
+	86:   {region: 0x3f, script: 0x5b, flags: 0x0},
+	87:   {region: 0x166, script: 0x5b, flags: 0x0},
+	88:   {region: 0x3, script: 0x5, flags: 0x1},
+	89:   {region: 0x107, script: 0x20, flags: 0x0},
+	90:   {region: 0xe9, script: 0x5, flags: 0x0},
+	91:   {region: 0x96, script: 0x5b, flags: 0x0},
+	92:   {region: 0xdc, script: 0x22, flags: 0x0},
+	93:   {region: 0x2e, script: 0x5b, flags: 0x0},
+	94:   {region: 0x52, script: 0x5b, flags: 0x0},
+	95:   {region: 0x166, script: 0x5b, flags: 0x0},
+	96:   {region: 0x52, script: 0xb, flags: 0x0},
+	97:   {region: 0x166, script: 0x5b, flags: 0x0},
+	98:   {region: 0x166, script: 0x5b, flags: 0x0},
+	99:   {region: 0x96, script: 0x5b, flags: 0x0},
+	100:  {region: 0x166, script: 0x5b, flags: 0x0},
+	101:  {region: 0x52, script: 0x5b, flags: 0x0},
+	102:  {region: 0x166, script: 0x5b, flags: 0x0},
+	103:  {region: 0x166, script: 0x5b, flags: 0x0},
+	104:  {region: 0x166, script: 0x5b, flags: 0x0},
+	105:  {region: 0x166, script: 0x5b, flags: 0x0},
+	106:  {region: 0x4f, script: 0x5b, flags: 0x0},
+	107:  {region: 0x166, script: 0x5b, flags: 0x0},
+	108:  {region: 0x166, script: 0x5b, flags: 0x0},
+	109:  {region: 0x166, script: 0x5b, flags: 0x0},
+	110:  {region: 0x166, script: 0x2c, flags: 0x0},
+	111:  {region: 0x166, script: 0x5b, flags: 0x0},
+	112:  {region: 0x166, script: 0x5b, flags: 0x0},
+	113:  {region: 0x47, script: 0x20, flags: 0x0},
+	114:  {region: 0x166, script: 0x5b, flags: 0x0},
+	115:  {region: 0x166, script: 0x5b, flags: 0x0},
+	116:  {region: 0x10c, script: 0x5, flags: 0x0},
+	117:  {region: 0x163, script: 0x5b, flags: 0x0},
+	118:  {region: 0x166, script: 0x5b, flags: 0x0},
+	119:  {region: 0x96, script: 0x5b, flags: 0x0},
+	120:  {region: 0x166, script: 0x5b, flags: 0x0},
+	121:  {region: 0x130, script: 0x5b, flags: 0x0},
+	122:  {region: 0x52, script: 0x5b, flags: 0x0},
+	123:  {region: 0x9a, script: 0xe6, flags: 0x0},
+	124:  {region: 0xe9, script: 0x5, flags: 0x0},
+	125:  {region: 0x9a, script: 0x22, flags: 0x0},
+	126:  {region: 0x38, script: 0x20, flags: 0x0},
+	127:  {region: 0x9a, script: 0x22, flags: 0x0},
+	128:  {region: 0xe9, script: 0x5, flags: 0x0},
+	129:  {region: 0x12c, script: 0x34, flags: 0x0},
+	131:  {region: 0x9a, script: 0x22, flags: 0x0},
+	132:  {region: 0x166, script: 0x5b, flags: 0x0},
+	133:  {region: 0x9a, script: 0x22, flags: 0x0},
+	134:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	135:  {region: 0x166, script: 0x5b, flags: 0x0},
+	136:  {region: 0x9a, script: 0x22, flags: 0x0},
+	137:  {region: 0x166, script: 0x5b, flags: 0x0},
+	138:  {region: 0x140, script: 0x5b, flags: 0x0},
+	139:  {region: 0x166, script: 0x5b, flags: 0x0},
+	140:  {region: 0x166, script: 0x5b, flags: 0x0},
+	141:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	142:  {region: 0x166, script: 0x5b, flags: 0x0},
+	143:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	144:  {region: 0x166, script: 0x5b, flags: 0x0},
+	145:  {region: 0x166, script: 0x5b, flags: 0x0},
+	146:  {region: 0x166, script: 0x5b, flags: 0x0},
+	147:  {region: 0x166, script: 0x2c, flags: 0x0},
+	148:  {region: 0x9a, script: 0x22, flags: 0x0},
+	149:  {region: 0x96, script: 0x5b, flags: 0x0},
+	150:  {region: 0x166, script: 0x5b, flags: 0x0},
+	151:  {region: 0x166, script: 0x5b, flags: 0x0},
+	152:  {region: 0x115, script: 0x5b, flags: 0x0},
+	153:  {region: 0x166, script: 0x5b, flags: 0x0},
+	154:  {region: 0x166, script: 0x5b, flags: 0x0},
+	155:  {region: 0x52, script: 0x5b, flags: 0x0},
+	156:  {region: 0x166, script: 0x5b, flags: 0x0},
+	157:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	158:  {region: 0x166, script: 0x5b, flags: 0x0},
+	159:  {region: 0x13f, script: 0xe8, flags: 0x0},
+	160:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	161:  {region: 0x166, script: 0x5b, flags: 0x0},
+	162:  {region: 0x166, script: 0x5b, flags: 0x0},
+	163:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	164:  {region: 0x166, script: 0x5b, flags: 0x0},
+	165:  {region: 0x35, script: 0xe, flags: 0x0},
+	166:  {region: 0x166, script: 0x5b, flags: 0x0},
+	167:  {region: 0x166, script: 0x5b, flags: 0x0},
+	168:  {region: 0x166, script: 0x5b, flags: 0x0},
+	169:  {region: 0x53, script: 0xef, flags: 0x0},
+	170:  {region: 0x166, script: 0x5b, flags: 0x0},
+	171:  {region: 0x166, script: 0x5b, flags: 0x0},
+	172:  {region: 0x166, script: 0x5b, flags: 0x0},
+	173:  {region: 0x9a, script: 0xe, flags: 0x0},
+	174:  {region: 0x166, script: 0x5b, flags: 0x0},
+	175:  {region: 0x9d, script: 0x5, flags: 0x0},
+	176:  {region: 0x166, script: 0x5b, flags: 0x0},
+	177:  {region: 0x4f, script: 0x5b, flags: 0x0},
+	178:  {region: 0x79, script: 0x5b, flags: 0x0},
+	179:  {region: 0x9a, script: 0x22, flags: 0x0},
+	180:  {region: 0xe9, script: 0x5, flags: 0x0},
+	181:  {region: 0x9a, script: 0x22, flags: 0x0},
+	182:  {region: 0x166, script: 0x5b, flags: 0x0},
+	183:  {region: 0x33, script: 0x5b, flags: 0x0},
+	184:  {region: 0x166, script: 0x5b, flags: 0x0},
+	185:  {region: 0xb5, script: 0xc, flags: 0x0},
+	186:  {region: 0x52, script: 0x5b, flags: 0x0},
+	187:  {region: 0x166, script: 0x2c, flags: 0x0},
+	188:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	189:  {region: 0x166, script: 0x5b, flags: 0x0},
+	190:  {region: 0xe9, script: 0x22, flags: 0x0},
+	191:  {region: 0x107, script: 0x20, flags: 0x0},
+	192:  {region: 0x160, script: 0x5b, flags: 0x0},
+	193:  {region: 0x166, script: 0x5b, flags: 0x0},
+	194:  {region: 0x96, script: 0x5b, flags: 0x0},
+	195:  {region: 0x166, script: 0x5b, flags: 0x0},
+	196:  {region: 0x52, script: 0x5b, flags: 0x0},
+	197:  {region: 0x166, script: 0x5b, flags: 0x0},
+	198:  {region: 0x166, script: 0x5b, flags: 0x0},
+	199:  {region: 0x166, script: 0x5b, flags: 0x0},
+	200:  {region: 0x87, script: 0x5b, flags: 0x0},
+	201:  {region: 0x166, script: 0x5b, flags: 0x0},
+	202:  {region: 0x166, script: 0x5b, flags: 0x0},
+	203:  {region: 0x166, script: 0x5b, flags: 0x0},
+	204:  {region: 0x166, script: 0x5b, flags: 0x0},
+	205:  {region: 0x6e, script: 0x2c, flags: 0x0},
+	206:  {region: 0x166, script: 0x5b, flags: 0x0},
+	207:  {region: 0x166, script: 0x5b, flags: 0x0},
+	208:  {region: 0x52, script: 0x5b, flags: 0x0},
+	209:  {region: 0x166, script: 0x5b, flags: 0x0},
+	210:  {region: 0x166, script: 0x5b, flags: 0x0},
+	211:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	212:  {region: 0x166, script: 0x5b, flags: 0x0},
+	213:  {region: 0x166, script: 0x5b, flags: 0x0},
+	214:  {region: 0x166, script: 0x5b, flags: 0x0},
+	215:  {region: 0x6f, script: 0x5b, flags: 0x0},
+	216:  {region: 0x166, script: 0x5b, flags: 0x0},
+	217:  {region: 0x166, script: 0x5b, flags: 0x0},
+	218:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	219:  {region: 0x35, script: 0x16, flags: 0x0},
+	220:  {region: 0x107, script: 0x20, flags: 0x0},
+	221:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	222:  {region: 0x166, script: 0x5b, flags: 0x0},
+	223:  {region: 0x132, script: 0x5b, flags: 0x0},
+	224:  {region: 0x8b, script: 0x5b, flags: 0x0},
+	225:  {region: 0x76, script: 0x5b, flags: 0x0},
+	226:  {region: 0x107, script: 0x20, flags: 0x0},
+	227:  {region: 0x136, script: 0x5b, flags: 0x0},
+	228:  {region: 0x49, script: 0x5b, flags: 0x0},
+	229:  {region: 0x136, script: 0x1a, flags: 0x0},
+	230:  {region: 0xa7, script: 0x5, flags: 0x0},
+	231:  {region: 0x13f, script: 0x19, flags: 0x0},
+	232:  {region: 0x166, script: 0x5b, flags: 0x0},
+	233:  {region: 0x9c, script: 0x5, flags: 0x0},
+	234:  {region: 0x166, script: 0x5b, flags: 0x0},
+	235:  {region: 0x166, script: 0x5b, flags: 0x0},
+	236:  {region: 0x166, script: 0x5b, flags: 0x0},
+	237:  {region: 0x166, script: 0x5b, flags: 0x0},
+	238:  {region: 0x166, script: 0x5b, flags: 0x0},
+	239:  {region: 0xc6, script: 0xda, flags: 0x0},
+	240:  {region: 0x79, script: 0x5b, flags: 0x0},
+	241:  {region: 0x6c, script: 0x1d, flags: 0x0},
+	242:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	243:  {region: 0x49, script: 0x17, flags: 0x0},
+	244:  {region: 0x131, script: 0x20, flags: 0x0},
+	245:  {region: 0x49, script: 0x17, flags: 0x0},
+	246:  {region: 0x49, script: 0x17, flags: 0x0},
+	247:  {region: 0x49, script: 0x17, flags: 0x0},
+	248:  {region: 0x49, script: 0x17, flags: 0x0},
+	249:  {region: 0x10b, script: 0x5b, flags: 0x0},
+	250:  {region: 0x5f, script: 0x5b, flags: 0x0},
+	251:  {region: 0xea, script: 0x5b, flags: 0x0},
+	252:  {region: 0x49, script: 0x17, flags: 0x0},
+	253:  {region: 0xc5, script: 0x88, flags: 0x0},
+	254:  {region: 0x8, script: 0x2, flags: 0x1},
+	255:  {region: 0x107, script: 0x20, flags: 0x0},
+	256:  {region: 0x7c, script: 0x5b, flags: 0x0},
+	257:  {region: 0x64, script: 0x5b, flags: 0x0},
+	258:  {region: 0x166, script: 0x5b, flags: 0x0},
+	259:  {region: 0x166, script: 0x5b, flags: 0x0},
+	260:  {region: 0x166, script: 0x5b, flags: 0x0},
+	261:  {region: 0x166, script: 0x5b, flags: 0x0},
+	262:  {region: 0x136, script: 0x5b, flags: 0x0},
+	263:  {region: 0x107, script: 0x20, flags: 0x0},
+	264:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	265:  {region: 0x166, script: 0x5b, flags: 0x0},
+	266:  {region: 0x166, script: 0x5b, flags: 0x0},
+	267:  {region: 0x9a, script: 0x5, flags: 0x0},
+	268:  {region: 0x166, script: 0x5b, flags: 0x0},
+	269:  {region: 0x61, script: 0x5b, flags: 0x0},
+	270:  {region: 0x166, script: 0x5b, flags: 0x0},
+	271:  {region: 0x49, script: 0x5b, flags: 0x0},
+	272:  {region: 0x166, script: 0x5b, flags: 0x0},
+	273:  {region: 0x166, script: 0x5b, flags: 0x0},
+	274:  {region: 0x166, script: 0x5b, flags: 0x0},
+	275:  {region: 0x166, script: 0x5, flags: 0x0},
+	276:  {region: 0x49, script: 0x5b, flags: 0x0},
+	277:  {region: 0x166, script: 0x5b, flags: 0x0},
+	278:  {region: 0x166, script: 0x5b, flags: 0x0},
+	279:  {region: 0xd5, script: 0x5b, flags: 0x0},
+	280:  {region: 0x4f, script: 0x5b, flags: 0x0},
+	281:  {region: 0x166, script: 0x5b, flags: 0x0},
+	282:  {region: 0x9a, script: 0x5, flags: 0x0},
+	283:  {region: 0x166, script: 0x5b, flags: 0x0},
+	284:  {region: 0x166, script: 0x5b, flags: 0x0},
+	285:  {region: 0x166, script: 0x5b, flags: 0x0},
+	286:  {region: 0x166, script: 0x2c, flags: 0x0},
+	287:  {region: 0x61, script: 0x5b, flags: 0x0},
+	288:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	289:  {region: 0xd1, script: 0x5b, flags: 0x0},
+	290:  {region: 0x166, script: 0x5b, flags: 0x0},
+	291:  {region: 0xdc, script: 0x22, flags: 0x0},
+	292:  {region: 0x52, script: 0x5b, flags: 0x0},
+	293:  {region: 0x166, script: 0x5b, flags: 0x0},
+	294:  {region: 0x166, script: 0x5b, flags: 0x0},
+	295:  {region: 0x166, script: 0x5b, flags: 0x0},
+	296:  {region: 0xce, script: 0xed, flags: 0x0},
+	297:  {region: 0x166, script: 0x5b, flags: 0x0},
+	298:  {region: 0x166, script: 0x5b, flags: 0x0},
+	299:  {region: 0x115, script: 0x5b, flags: 0x0},
+	300:  {region: 0x37, script: 0x5b, flags: 0x0},
+	301:  {region: 0x43, script: 0xef, flags: 0x0},
+	302:  {region: 0x166, script: 0x5b, flags: 0x0},
+	303:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	304:  {region: 0x81, script: 0x5b, flags: 0x0},
+	305:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	306:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	307:  {region: 0x6c, script: 0x29, flags: 0x0},
+	308:  {region: 0x166, script: 0x5b, flags: 0x0},
+	309:  {region: 0xc5, script: 0x4b, flags: 0x0},
+	310:  {region: 0x88, script: 0x34, flags: 0x0},
+	311:  {region: 0x166, script: 0x5b, flags: 0x0},
+	312:  {region: 0x166, script: 0x5b, flags: 0x0},
+	313:  {region: 0xa, script: 0x2, flags: 0x1},
+	314:  {region: 0x166, script: 0x5b, flags: 0x0},
+	315:  {region: 0x166, script: 0x5b, flags: 0x0},
+	316:  {region: 0x1, script: 0x5b, flags: 0x0},
+	317:  {region: 0x166, script: 0x5b, flags: 0x0},
+	318:  {region: 0x6f, script: 0x5b, flags: 0x0},
+	319:  {region: 0x136, script: 0x5b, flags: 0x0},
+	320:  {region: 0x6b, script: 0x5b, flags: 0x0},
+	321:  {region: 0x166, script: 0x5b, flags: 0x0},
+	322:  {region: 0x9f, script: 0x46, flags: 0x0},
+	323:  {region: 0x166, script: 0x5b, flags: 0x0},
+	324:  {region: 0x166, script: 0x5b, flags: 0x0},
+	325:  {region: 0x6f, script: 0x5b, flags: 0x0},
+	326:  {region: 0x52, script: 0x5b, flags: 0x0},
+	327:  {region: 0x6f, script: 0x5b, flags: 0x0},
+	328:  {region: 0x9d, script: 0x5, flags: 0x0},
+	329:  {region: 0x166, script: 0x5b, flags: 0x0},
+	330:  {region: 0x166, script: 0x5b, flags: 0x0},
+	331:  {region: 0x166, script: 0x5b, flags: 0x0},
+	332:  {region: 0x166, script: 0x5b, flags: 0x0},
+	333:  {region: 0x87, script: 0x5b, flags: 0x0},
+	334:  {region: 0xc, script: 0x2, flags: 0x1},
+	335:  {region: 0x166, script: 0x5b, flags: 0x0},
+	336:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	337:  {region: 0x73, script: 0x5b, flags: 0x0},
+	338:  {region: 0x10c, script: 0x5, flags: 0x0},
+	339:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	340:  {region: 0x10d, script: 0x5b, flags: 0x0},
+	341:  {region: 0x74, script: 0x5b, flags: 0x0},
+	342:  {region: 0x166, script: 0x5b, flags: 0x0},
+	343:  {region: 0x166, script: 0x5b, flags: 0x0},
+	344:  {region: 0x77, script: 0x5b, flags: 0x0},
+	345:  {region: 0x166, script: 0x5b, flags: 0x0},
+	346:  {region: 0x3b, script: 0x5b, flags: 0x0},
+	347:  {region: 0x166, script: 0x5b, flags: 0x0},
+	348:  {region: 0x166, script: 0x5b, flags: 0x0},
+	349:  {region: 0x166, script: 0x5b, flags: 0x0},
+	350:  {region: 0x79, script: 0x5b, flags: 0x0},
+	351:  {region: 0x136, script: 0x5b, flags: 0x0},
+	352:  {region: 0x79, script: 0x5b, flags: 0x0},
+	353:  {region: 0x61, script: 0x5b, flags: 0x0},
+	354:  {region: 0x61, script: 0x5b, flags: 0x0},
+	355:  {region: 0x52, script: 0x5, flags: 0x0},
+	356:  {region: 0x141, script: 0x5b, flags: 0x0},
+	357:  {region: 0x166, script: 0x5b, flags: 0x0},
+	358:  {region: 0x85, script: 0x5b, flags: 0x0},
+	359:  {region: 0x166, script: 0x5b, flags: 0x0},
+	360:  {region: 0xd5, script: 0x5b, flags: 0x0},
+	361:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	362:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	363:  {region: 0x166, script: 0x5b, flags: 0x0},
+	364:  {region: 0x10c, script: 0x5b, flags: 0x0},
+	365:  {region: 0xda, script: 0x5b, flags: 0x0},
+	366:  {region: 0x97, script: 0x5b, flags: 0x0},
+	367:  {region: 0x81, script: 0x5b, flags: 0x0},
+	368:  {region: 0x166, script: 0x5b, flags: 0x0},
+	369:  {region: 0xbd, script: 0x5b, flags: 0x0},
+	370:  {region: 0x166, script: 0x5b, flags: 0x0},
+	371:  {region: 0x166, script: 0x5b, flags: 0x0},
+	372:  {region: 0x166, script: 0x5b, flags: 0x0},
+	373:  {region: 0x53, script: 0x3b, flags: 0x0},
+	374:  {region: 0x166, script: 0x5b, flags: 0x0},
+	375:  {region: 0x96, script: 0x5b, flags: 0x0},
+	376:  {region: 0x166, script: 0x5b, flags: 0x0},
+	377:  {region: 0x166, script: 0x5b, flags: 0x0},
+	378:  {region: 0x9a, script: 0x22, flags: 0x0},
+	379:  {region: 0x166, script: 0x5b, flags: 0x0},
+	380:  {region: 0x9d, script: 0x5, flags: 0x0},
+	381:  {region: 0x7f, script: 0x5b, flags: 0x0},
+	382:  {region: 0x7c, script: 0x5b, flags: 0x0},
+	383:  {region: 0x166, script: 0x5b, flags: 0x0},
+	384:  {region: 0x166, script: 0x5b, flags: 0x0},
+	385:  {region: 0x166, script: 0x5b, flags: 0x0},
+	386:  {region: 0x166, script: 0x5b, flags: 0x0},
+	387:  {region: 0x166, script: 0x5b, flags: 0x0},
+	388:  {region: 0x166, script: 0x5b, flags: 0x0},
+	389:  {region: 0x70, script: 0x2c, flags: 0x0},
+	390:  {region: 0x166, script: 0x5b, flags: 0x0},
+	391:  {region: 0xdc, script: 0x22, flags: 0x0},
+	392:  {region: 0x166, script: 0x5b, flags: 0x0},
+	393:  {region: 0xa8, script: 0x5b, flags: 0x0},
+	394:  {region: 0x166, script: 0x5b, flags: 0x0},
+	395:  {region: 0xe9, script: 0x5, flags: 0x0},
+	396:  {region: 0x166, script: 0x5b, flags: 0x0},
+	397:  {region: 0xe9, script: 0x5, flags: 0x0},
+	398:  {region: 0x166, script: 0x5b, flags: 0x0},
+	399:  {region: 0x166, script: 0x5b, flags: 0x0},
+	400:  {region: 0x6f, script: 0x5b, flags: 0x0},
+	401:  {region: 0x9d, script: 0x5, flags: 0x0},
+	402:  {region: 0x166, script: 0x5b, flags: 0x0},
+	403:  {region: 0x166, script: 0x2c, flags: 0x0},
+	404:  {region: 0xf2, script: 0x5b, flags: 0x0},
+	405:  {region: 0x166, script: 0x5b, flags: 0x0},
+	406:  {region: 0x166, script: 0x5b, flags: 0x0},
+	407:  {region: 0x166, script: 0x5b, flags: 0x0},
+	408:  {region: 0x166, script: 0x2c, flags: 0x0},
+	409:  {region: 0x166, script: 0x5b, flags: 0x0},
+	410:  {region: 0x9a, script: 0x22, flags: 0x0},
+	411:  {region: 0x9a, script: 0xe9, flags: 0x0},
+	412:  {region: 0x96, script: 0x5b, flags: 0x0},
+	413:  {region: 0xda, script: 0x5b, flags: 0x0},
+	414:  {region: 0x131, script: 0x32, flags: 0x0},
+	415:  {region: 0x166, script: 0x5b, flags: 0x0},
+	416:  {region: 0xe, script: 0x2, flags: 0x1},
+	417:  {region: 0x9a, script: 0xe, flags: 0x0},
+	418:  {region: 0x166, script: 0x5b, flags: 0x0},
+	419:  {region: 0x4e, script: 0x5b, flags: 0x0},
+	420:  {region: 0x9a, script: 0x35, flags: 0x0},
+	421:  {region: 0x41, script: 0x5b, flags: 0x0},
+	422:  {region: 0x54, script: 0x5b, flags: 0x0},
+	423:  {region: 0x166, script: 0x5b, flags: 0x0},
+	424:  {region: 0x81, script: 0x5b, flags: 0x0},
+	425:  {region: 0x166, script: 0x5b, flags: 0x0},
+	426:  {region: 0x166, script: 0x5b, flags: 0x0},
+	427:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	428:  {region: 0x99, script: 0x5b, flags: 0x0},
+	429:  {region: 0x166, script: 0x5b, flags: 0x0},
+	430:  {region: 0xdc, script: 0x22, flags: 0x0},
+	431:  {region: 0x166, script: 0x5b, flags: 0x0},
+	432:  {region: 0x166, script: 0x5, flags: 0x0},
+	433:  {region: 0x49, script: 0x5b, flags: 0x0},
+	434:  {region: 0x166, script: 0x5, flags: 0x0},
+	435:  {region: 0x166, script: 0x5b, flags: 0x0},
+	436:  {region: 0x10, script: 0x3, flags: 0x1},
+	437:  {region: 0x166, script: 0x5b, flags: 0x0},
+	438:  {region: 0x53, script: 0x3b, flags: 0x0},
+	439:  {region: 0x166, script: 0x5b, flags: 0x0},
+	440:  {region: 0x136, script: 0x5b, flags: 0x0},
+	441:  {region: 0x24, script: 0x5, flags: 0x0},
+	442:  {region: 0x166, script: 0x5b, flags: 0x0},
+	443:  {region: 0x166, script: 0x2c, flags: 0x0},
+	444:  {region: 0x98, script: 0x3e, flags: 0x0},
+	445:  {region: 0x166, script: 0x5b, flags: 0x0},
+	446:  {region: 0x9a, script: 0x22, flags: 0x0},
+	447:  {region: 0x166, script: 0x5b, flags: 0x0},
+	448:  {region: 0x74, script: 0x5b, flags: 0x0},
+	449:  {region: 0x166, script: 0x5b, flags: 0x0},
+	450:  {region: 0x166, script: 0x5b, flags: 0x0},
+	451:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	452:  {region: 0x166, script: 0x5b, flags: 0x0},
+	453:  {region: 0x12c, script: 0x40, flags: 0x0},
+	454:  {region: 0x53, script: 0x92, flags: 0x0},
+	455:  {region: 0x166, script: 0x5b, flags: 0x0},
+	456:  {region: 0xe9, script: 0x5, flags: 0x0},
+	457:  {region: 0x9a, script: 0x22, flags: 0x0},
+	458:  {region: 0xb0, script: 0x41, flags: 0x0},
+	459:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	460:  {region: 0xe9, script: 0x5, flags: 0x0},
+	461:  {region: 0xe7, script: 0x5b, flags: 0x0},
+	462:  {region: 0x9a, script: 0x22, flags: 0x0},
+	463:  {region: 0x9a, script: 0x22, flags: 0x0},
+	464:  {region: 0x166, script: 0x5b, flags: 0x0},
+	465:  {region: 0x91, script: 0x5b, flags: 0x0},
+	466:  {region: 0x61, script: 0x5b, flags: 0x0},
+	467:  {region: 0x53, script: 0x3b, flags: 0x0},
+	468:  {region: 0x92, script: 0x5b, flags: 0x0},
+	469:  {region: 0x93, script: 0x5b, flags: 0x0},
+	470:  {region: 0x166, script: 0x5b, flags: 0x0},
+	471:  {region: 0x28, script: 0x8, flags: 0x0},
+	472:  {region: 0xd3, script: 0x5b, flags: 0x0},
+	473:  {region: 0x79, script: 0x5b, flags: 0x0},
+	474:  {region: 0x166, script: 0x5b, flags: 0x0},
+	475:  {region: 0x166, script: 0x5b, flags: 0x0},
+	476:  {region: 0xd1, script: 0x5b, flags: 0x0},
+	477:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	478:  {region: 0x166, script: 0x5b, flags: 0x0},
+	479:  {region: 0x166, script: 0x5b, flags: 0x0},
+	480:  {region: 0x166, script: 0x5b, flags: 0x0},
+	481:  {region: 0x96, script: 0x5b, flags: 0x0},
+	482:  {region: 0x166, script: 0x5b, flags: 0x0},
+	483:  {region: 0x166, script: 0x5b, flags: 0x0},
+	484:  {region: 0x166, script: 0x5b, flags: 0x0},
+	486:  {region: 0x123, script: 0x5b, flags: 0x0},
+	487:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	488:  {region: 0x166, script: 0x5b, flags: 0x0},
+	489:  {region: 0x166, script: 0x5b, flags: 0x0},
+	490:  {region: 0x53, script: 0xfd, flags: 0x0},
+	491:  {region: 0x166, script: 0x5b, flags: 0x0},
+	492:  {region: 0x136, script: 0x5b, flags: 0x0},
+	493:  {region: 0x166, script: 0x5b, flags: 0x0},
+	494:  {region: 0x49, script: 0x5b, flags: 0x0},
+	495:  {region: 0x166, script: 0x5b, flags: 0x0},
+	496:  {region: 0x166, script: 0x5b, flags: 0x0},
+	497:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	498:  {region: 0x166, script: 0x5b, flags: 0x0},
+	499:  {region: 0x96, script: 0x5b, flags: 0x0},
+	500:  {region: 0x107, script: 0x20, flags: 0x0},
+	501:  {region: 0x1, script: 0x5b, flags: 0x0},
+	502:  {region: 0x166, script: 0x5b, flags: 0x0},
+	503:  {region: 0x166, script: 0x5b, flags: 0x0},
+	504:  {region: 0x9e, script: 0x5b, flags: 0x0},
+	505:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	506:  {region: 0x49, script: 0x17, flags: 0x0},
+	507:  {region: 0x98, script: 0x3e, flags: 0x0},
+	508:  {region: 0x166, script: 0x5b, flags: 0x0},
+	509:  {region: 0x166, script: 0x5b, flags: 0x0},
+	510:  {region: 0x107, script: 0x5b, flags: 0x0},
+	511:  {region: 0x166, script: 0x5b, flags: 0x0},
+	512:  {region: 0xa3, script: 0x49, flags: 0x0},
+	513:  {region: 0x166, script: 0x5b, flags: 0x0},
+	514:  {region: 0xa1, script: 0x5b, flags: 0x0},
+	515:  {region: 0x1, script: 0x5b, flags: 0x0},
+	516:  {region: 0x166, script: 0x5b, flags: 0x0},
+	517:  {region: 0x166, script: 0x5b, flags: 0x0},
+	518:  {region: 0x166, script: 0x5b, flags: 0x0},
+	519:  {region: 0x52, script: 0x5b, flags: 0x0},
+	520:  {region: 0x131, script: 0x3e, flags: 0x0},
+	521:  {region: 0x166, script: 0x5b, flags: 0x0},
+	522:  {region: 0x130, script: 0x5b, flags: 0x0},
+	523:  {region: 0xdc, script: 0x22, flags: 0x0},
+	524:  {region: 0x166, script: 0x5b, flags: 0x0},
+	525:  {region: 0x64, script: 0x5b, flags: 0x0},
+	526:  {region: 0x96, script: 0x5b, flags: 0x0},
+	527:  {region: 0x96, script: 0x5b, flags: 0x0},
+	528:  {region: 0x7e, script: 0x2e, flags: 0x0},
+	529:  {region: 0x138, script: 0x20, flags: 0x0},
+	530:  {region: 0x68, script: 0x5b, flags: 0x0},
+	531:  {region: 0xc5, script: 0x5b, flags: 0x0},
+	532:  {region: 0x166, script: 0x5b, flags: 0x0},
+	533:  {region: 0x166, script: 0x5b, flags: 0x0},
+	534:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	535:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	536:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	537:  {region: 0x107, script: 0x20, flags: 0x0},
+	538:  {region: 0x166, script: 0x5b, flags: 0x0},
+	539:  {region: 0x166, script: 0x5b, flags: 0x0},
+	540:  {region: 0x166, script: 0x5b, flags: 0x0},
+	541:  {region: 0x166, script: 0x5b, flags: 0x0},
+	542:  {region: 0xd5, script: 0x5, flags: 0x0},
+	543:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	544:  {region: 0x165, script: 0x5b, flags: 0x0},
+	545:  {region: 0x166, script: 0x5b, flags: 0x0},
+	546:  {region: 0x166, script: 0x5b, flags: 0x0},
+	547:  {region: 0x130, script: 0x5b, flags: 0x0},
+	548:  {region: 0x123, script: 0x5, flags: 0x0},
+	549:  {region: 0x166, script: 0x5b, flags: 0x0},
+	550:  {region: 0x124, script: 0xee, flags: 0x0},
+	551:  {region: 0x5b, script: 0x5b, flags: 0x0},
+	552:  {region: 0x52, script: 0x5b, flags: 0x0},
+	553:  {region: 0x166, script: 0x5b, flags: 0x0},
+	554:  {region: 0x4f, script: 0x5b, flags: 0x0},
+	555:  {region: 0x9a, script: 0x22, flags: 0x0},
+	556:  {region: 0x9a, script: 0x22, flags: 0x0},
+	557:  {region: 0x4b, script: 0x5b, flags: 0x0},
+	558:  {region: 0x96, script: 0x5b, flags: 0x0},
+	559:  {region: 0x166, script: 0x5b, flags: 0x0},
+	560:  {region: 0x41, script: 0x5b, flags: 0x0},
+	561:  {region: 0x9a, script: 0x5b, flags: 0x0},
+	562:  {region: 0x53, script: 0xe5, flags: 0x0},
+	563:  {region: 0x9a, script: 0x22, flags: 0x0},
+	564:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	565:  {region: 0x166, script: 0x5b, flags: 0x0},
+	566:  {region: 0x9a, script: 0x76, flags: 0x0},
+	567:  {region: 0xe9, script: 0x5, flags: 0x0},
+	568:  {region: 0x166, script: 0x5b, flags: 0x0},
+	569:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	570:  {region: 0x166, script: 0x5b, flags: 0x0},
+	571:  {region: 0x12c, script: 0x5b, flags: 0x0},
+	572:  {region: 0x166, script: 0x5b, flags: 0x0},
+	573:  {region: 0xd3, script: 0x5b, flags: 0x0},
+	574:  {region: 0x166, script: 0x5b, flags: 0x0},
+	575:  {region: 0xb0, script: 0x58, flags: 0x0},
+	576:  {region: 0x166, script: 0x5b, flags: 0x0},
+	577:  {region: 0x166, script: 0x5b, flags: 0x0},
+	578:  {region: 0x13, script: 0x6, flags: 0x1},
+	579:  {region: 0x166, script: 0x5b, flags: 0x0},
+	580:  {region: 0x52, script: 0x5b, flags: 0x0},
+	581:  {region: 0x83, script: 0x5b, flags: 0x0},
+	582:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	583:  {region: 0x166, script: 0x5b, flags: 0x0},
+	584:  {region: 0x166, script: 0x5b, flags: 0x0},
+	585:  {region: 0x166, script: 0x5b, flags: 0x0},
+	586:  {region: 0xa7, script: 0x4f, flags: 0x0},
+	587:  {region: 0x2a, script: 0x5b, flags: 0x0},
+	588:  {region: 0x166, script: 0x5b, flags: 0x0},
+	589:  {region: 0x166, script: 0x5b, flags: 0x0},
+	590:  {region: 0x166, script: 0x5b, flags: 0x0},
+	591:  {region: 0x166, script: 0x5b, flags: 0x0},
+	592:  {region: 0x166, script: 0x5b, flags: 0x0},
+	593:  {region: 0x9a, script: 0x53, flags: 0x0},
+	594:  {region: 0x8c, script: 0x5b, flags: 0x0},
+	595:  {region: 0x166, script: 0x5b, flags: 0x0},
+	596:  {region: 0xac, script: 0x54, flags: 0x0},
+	597:  {region: 0x107, script: 0x20, flags: 0x0},
+	598:  {region: 0x9a, script: 0x22, flags: 0x0},
+	599:  {region: 0x166, script: 0x5b, flags: 0x0},
+	600:  {region: 0x76, script: 0x5b, flags: 0x0},
+	601:  {region: 0x166, script: 0x5b, flags: 0x0},
+	602:  {region: 0xb5, script: 0x5b, flags: 0x0},
+	603:  {region: 0x166, script: 0x5b, flags: 0x0},
+	604:  {region: 0x166, script: 0x5b, flags: 0x0},
+	605:  {region: 0x166, script: 0x5b, flags: 0x0},
+	606:  {region: 0x166, script: 0x5b, flags: 0x0},
+	607:  {region: 0x166, script: 0x5b, flags: 0x0},
+	608:  {region: 0x166, script: 0x5b, flags: 0x0},
+	609:  {region: 0x166, script: 0x5b, flags: 0x0},
+	610:  {region: 0x166, script: 0x2c, flags: 0x0},
+	611:  {region: 0x166, script: 0x5b, flags: 0x0},
+	612:  {region: 0x107, script: 0x20, flags: 0x0},
+	613:  {region: 0x113, script: 0x5b, flags: 0x0},
+	614:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	615:  {region: 0x107, script: 0x5b, flags: 0x0},
+	616:  {region: 0x166, script: 0x5b, flags: 0x0},
+	617:  {region: 0x9a, script: 0x22, flags: 0x0},
+	618:  {region: 0x9a, script: 0x5, flags: 0x0},
+	619:  {region: 0x130, script: 0x5b, flags: 0x0},
+	620:  {region: 0x166, script: 0x5b, flags: 0x0},
+	621:  {region: 0x52, script: 0x5b, flags: 0x0},
+	622:  {region: 0x61, script: 0x5b, flags: 0x0},
+	623:  {region: 0x166, script: 0x5b, flags: 0x0},
+	624:  {region: 0x166, script: 0x5b, flags: 0x0},
+	625:  {region: 0x166, script: 0x2c, flags: 0x0},
+	626:  {region: 0x166, script: 0x5b, flags: 0x0},
+	627:  {region: 0x166, script: 0x5b, flags: 0x0},
+	628:  {region: 0x19, script: 0x3, flags: 0x1},
+	629:  {region: 0x166, script: 0x5b, flags: 0x0},
+	630:  {region: 0x166, script: 0x5b, flags: 0x0},
+	631:  {region: 0x166, script: 0x5b, flags: 0x0},
+	632:  {region: 0x166, script: 0x5b, flags: 0x0},
+	633:  {region: 0x107, script: 0x20, flags: 0x0},
+	634:  {region: 0x166, script: 0x5b, flags: 0x0},
+	635:  {region: 0x166, script: 0x5b, flags: 0x0},
+	636:  {region: 0x166, script: 0x5b, flags: 0x0},
+	637:  {region: 0x107, script: 0x20, flags: 0x0},
+	638:  {region: 0x166, script: 0x5b, flags: 0x0},
+	639:  {region: 0x96, script: 0x5b, flags: 0x0},
+	640:  {region: 0xe9, script: 0x5, flags: 0x0},
+	641:  {region: 0x7c, script: 0x5b, flags: 0x0},
+	642:  {region: 0x166, script: 0x5b, flags: 0x0},
+	643:  {region: 0x166, script: 0x5b, flags: 0x0},
+	644:  {region: 0x166, script: 0x5b, flags: 0x0},
+	645:  {region: 0x166, script: 0x2c, flags: 0x0},
+	646:  {region: 0x124, script: 0xee, flags: 0x0},
+	647:  {region: 0xe9, script: 0x5, flags: 0x0},
+	648:  {region: 0x166, script: 0x5b, flags: 0x0},
+	649:  {region: 0x166, script: 0x5b, flags: 0x0},
+	650:  {region: 0x1c, script: 0x5, flags: 0x1},
+	651:  {region: 0x166, script: 0x5b, flags: 0x0},
+	652:  {region: 0x166, script: 0x5b, flags: 0x0},
+	653:  {region: 0x166, script: 0x5b, flags: 0x0},
+	654:  {region: 0x139, script: 0x5b, flags: 0x0},
+	655:  {region: 0x88, script: 0x5f, flags: 0x0},
+	656:  {region: 0x98, script: 0x3e, flags: 0x0},
+	657:  {region: 0x130, script: 0x5b, flags: 0x0},
+	658:  {region: 0xe9, script: 0x5, flags: 0x0},
+	659:  {region: 0x132, script: 0x5b, flags: 0x0},
+	660:  {region: 0x166, script: 0x5b, flags: 0x0},
+	661:  {region: 0xb8, script: 0x5b, flags: 0x0},
+	662:  {region: 0x107, script: 0x20, flags: 0x0},
+	663:  {region: 0x166, script: 0x5b, flags: 0x0},
+	664:  {region: 0x96, script: 0x5b, flags: 0x0},
+	665:  {region: 0x166, script: 0x5b, flags: 0x0},
+	666:  {region: 0x53, script: 0xee, flags: 0x0},
+	667:  {region: 0x166, script: 0x5b, flags: 0x0},
+	668:  {region: 0x166, script: 0x5b, flags: 0x0},
+	669:  {region: 0x166, script: 0x5b, flags: 0x0},
+	670:  {region: 0x166, script: 0x5b, flags: 0x0},
+	671:  {region: 0x9a, script: 0x5d, flags: 0x0},
+	672:  {region: 0x166, script: 0x5b, flags: 0x0},
+	673:  {region: 0x166, script: 0x5b, flags: 0x0},
+	674:  {region: 0x107, script: 0x20, flags: 0x0},
+	675:  {region: 0x132, script: 0x5b, flags: 0x0},
+	676:  {region: 0x166, script: 0x5b, flags: 0x0},
+	677:  {region: 0xda, script: 0x5b, flags: 0x0},
+	678:  {region: 0x166, script: 0x5b, flags: 0x0},
+	679:  {region: 0x166, script: 0x5b, flags: 0x0},
+	680:  {region: 0x21, script: 0x2, flags: 0x1},
+	681:  {region: 0x166, script: 0x5b, flags: 0x0},
+	682:  {region: 0x166, script: 0x5b, flags: 0x0},
+	683:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	684:  {region: 0x53, script: 0x61, flags: 0x0},
+	685:  {region: 0x96, script: 0x5b, flags: 0x0},
+	686:  {region: 0x9d, script: 0x5, flags: 0x0},
+	687:  {region: 0x136, script: 0x5b, flags: 0x0},
+	688:  {region: 0x166, script: 0x5b, flags: 0x0},
+	689:  {region: 0x166, script: 0x5b, flags: 0x0},
+	690:  {region: 0x9a, script: 0xe9, flags: 0x0},
+	691:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	692:  {region: 0x166, script: 0x5b, flags: 0x0},
+	693:  {region: 0x4b, script: 0x5b, flags: 0x0},
+	694:  {region: 0x166, script: 0x5b, flags: 0x0},
+	695:  {region: 0x166, script: 0x5b, flags: 0x0},
+	696:  {region: 0xb0, script: 0x58, flags: 0x0},
+	697:  {region: 0x166, script: 0x5b, flags: 0x0},
+	698:  {region: 0x166, script: 0x5b, flags: 0x0},
+	699:  {region: 0x4b, script: 0x5b, flags: 0x0},
+	700:  {region: 0x166, script: 0x5b, flags: 0x0},
+	701:  {region: 0x166, script: 0x5b, flags: 0x0},
+	702:  {region: 0x163, script: 0x5b, flags: 0x0},
+	703:  {region: 0x9d, script: 0x5, flags: 0x0},
+	704:  {region: 0xb7, script: 0x5b, flags: 0x0},
+	705:  {region: 0xb9, script: 0x5b, flags: 0x0},
+	706:  {region: 0x4b, script: 0x5b, flags: 0x0},
+	707:  {region: 0x4b, script: 0x5b, flags: 0x0},
+	708:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	709:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	710:  {region: 0x9d, script: 0x5, flags: 0x0},
+	711:  {region: 0xb9, script: 0x5b, flags: 0x0},
+	712:  {region: 0x124, script: 0xee, flags: 0x0},
+	713:  {region: 0x53, script: 0x3b, flags: 0x0},
+	714:  {region: 0x12c, script: 0x5b, flags: 0x0},
+	715:  {region: 0x96, script: 0x5b, flags: 0x0},
+	716:  {region: 0x52, script: 0x5b, flags: 0x0},
+	717:  {region: 0x9a, script: 0x22, flags: 0x0},
+	718:  {region: 0x9a, script: 0x22, flags: 0x0},
+	719:  {region: 0x96, script: 0x5b, flags: 0x0},
+	720:  {region: 0x23, script: 0x3, flags: 0x1},
+	721:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	722:  {region: 0x166, script: 0x5b, flags: 0x0},
+	723:  {region: 0xd0, script: 0x5b, flags: 0x0},
+	724:  {region: 0x166, script: 0x5b, flags: 0x0},
+	725:  {region: 0x166, script: 0x5b, flags: 0x0},
+	726:  {region: 0x166, script: 0x5b, flags: 0x0},
+	727:  {region: 0x166, script: 0x5b, flags: 0x0},
+	728:  {region: 0x166, script: 0x5b, flags: 0x0},
+	729:  {region: 0x166, script: 0x5b, flags: 0x0},
+	730:  {region: 0x166, script: 0x5b, flags: 0x0},
+	731:  {region: 0x166, script: 0x5b, flags: 0x0},
+	732:  {region: 0x166, script: 0x5b, flags: 0x0},
+	733:  {region: 0x166, script: 0x5b, flags: 0x0},
+	734:  {region: 0x166, script: 0x5b, flags: 0x0},
+	735:  {region: 0x166, script: 0x5, flags: 0x0},
+	736:  {region: 0x107, script: 0x20, flags: 0x0},
+	737:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	738:  {region: 0x166, script: 0x5b, flags: 0x0},
+	739:  {region: 0x96, script: 0x5b, flags: 0x0},
+	740:  {region: 0x166, script: 0x2c, flags: 0x0},
+	741:  {region: 0x166, script: 0x5b, flags: 0x0},
+	742:  {region: 0x166, script: 0x5b, flags: 0x0},
+	743:  {region: 0x166, script: 0x5b, flags: 0x0},
+	744:  {region: 0x113, script: 0x5b, flags: 0x0},
+	745:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	746:  {region: 0x166, script: 0x5b, flags: 0x0},
+	747:  {region: 0x166, script: 0x5b, flags: 0x0},
+	748:  {region: 0x124, script: 0x5, flags: 0x0},
+	749:  {region: 0xcd, script: 0x5b, flags: 0x0},
+	750:  {region: 0x166, script: 0x5b, flags: 0x0},
+	751:  {region: 0x166, script: 0x5b, flags: 0x0},
+	752:  {region: 0x166, script: 0x5b, flags: 0x0},
+	753:  {region: 0xc0, script: 0x5b, flags: 0x0},
+	754:  {region: 0xd2, script: 0x5b, flags: 0x0},
+	755:  {region: 0x166, script: 0x5b, flags: 0x0},
+	756:  {region: 0x52, script: 0x5b, flags: 0x0},
+	757:  {region: 0xdc, script: 0x22, flags: 0x0},
+	758:  {region: 0x130, script: 0x5b, flags: 0x0},
+	759:  {region: 0xc1, script: 0x5b, flags: 0x0},
+	760:  {region: 0x166, script: 0x5b, flags: 0x0},
+	761:  {region: 0x166, script: 0x5b, flags: 0x0},
+	762:  {region: 0xe1, script: 0x5b, flags: 0x0},
+	763:  {region: 0x166, script: 0x5b, flags: 0x0},
+	764:  {region: 0x96, script: 0x5b, flags: 0x0},
+	765:  {region: 0x9c, script: 0x3d, flags: 0x0},
+	766:  {region: 0x166, script: 0x5b, flags: 0x0},
+	767:  {region: 0xc3, script: 0x20, flags: 0x0},
+	768:  {region: 0x166, script: 0x5, flags: 0x0},
+	769:  {region: 0x166, script: 0x5b, flags: 0x0},
+	770:  {region: 0x166, script: 0x5b, flags: 0x0},
+	771:  {region: 0x166, script: 0x5b, flags: 0x0},
+	772:  {region: 0x9a, script: 0x6f, flags: 0x0},
+	773:  {region: 0x166, script: 0x5b, flags: 0x0},
+	774:  {region: 0x166, script: 0x5b, flags: 0x0},
+	775:  {region: 0x10c, script: 0x5b, flags: 0x0},
+	776:  {region: 0x166, script: 0x5b, flags: 0x0},
+	777:  {region: 0x166, script: 0x5b, flags: 0x0},
+	778:  {region: 0x166, script: 0x5b, flags: 0x0},
+	779:  {region: 0x26, script: 0x3, flags: 0x1},
+	780:  {region: 0x166, script: 0x5b, flags: 0x0},
+	781:  {region: 0x166, script: 0x5b, flags: 0x0},
+	782:  {region: 0x9a, script: 0xe, flags: 0x0},
+	783:  {region: 0xc5, script: 0x76, flags: 0x0},
+	785:  {region: 0x166, script: 0x5b, flags: 0x0},
+	786:  {region: 0x49, script: 0x5b, flags: 0x0},
+	787:  {region: 0x49, script: 0x5b, flags: 0x0},
+	788:  {region: 0x37, script: 0x5b, flags: 0x0},
+	789:  {region: 0x166, script: 0x5b, flags: 0x0},
+	790:  {region: 0x166, script: 0x5b, flags: 0x0},
+	791:  {region: 0x166, script: 0x5b, flags: 0x0},
+	792:  {region: 0x166, script: 0x5b, flags: 0x0},
+	793:  {region: 0x166, script: 0x5b, flags: 0x0},
+	794:  {region: 0x166, script: 0x5b, flags: 0x0},
+	795:  {region: 0x9a, script: 0x22, flags: 0x0},
+	796:  {region: 0xdc, script: 0x22, flags: 0x0},
+	797:  {region: 0x107, script: 0x20, flags: 0x0},
+	798:  {region: 0x35, script: 0x73, flags: 0x0},
+	799:  {region: 0x29, script: 0x3, flags: 0x1},
+	800:  {region: 0xcc, script: 0x5b, flags: 0x0},
+	801:  {region: 0x166, script: 0x5b, flags: 0x0},
+	802:  {region: 0x166, script: 0x5b, flags: 0x0},
+	803:  {region: 0x166, script: 0x5b, flags: 0x0},
+	804:  {region: 0x9a, script: 0x22, flags: 0x0},
+	805:  {region: 0x52, script: 0x5b, flags: 0x0},
+	807:  {region: 0x166, script: 0x5b, flags: 0x0},
+	808:  {region: 0x136, script: 0x5b, flags: 0x0},
+	809:  {region: 0x166, script: 0x5b, flags: 0x0},
+	810:  {region: 0x166, script: 0x5b, flags: 0x0},
+	811:  {region: 0xe9, script: 0x5, flags: 0x0},
+	812:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	813:  {region: 0x9a, script: 0x22, flags: 0x0},
+	814:  {region: 0x96, script: 0x5b, flags: 0x0},
+	815:  {region: 0x165, script: 0x5b, flags: 0x0},
+	816:  {region: 0x166, script: 0x5b, flags: 0x0},
+	817:  {region: 0xc5, script: 0x76, flags: 0x0},
+	818:  {region: 0x166, script: 0x5b, flags: 0x0},
+	819:  {region: 0x166, script: 0x2c, flags: 0x0},
+	820:  {region: 0x107, script: 0x20, flags: 0x0},
+	821:  {region: 0x166, script: 0x5b, flags: 0x0},
+	822:  {region: 0x132, script: 0x5b, flags: 0x0},
+	823:  {region: 0x9d, script: 0x67, flags: 0x0},
+	824:  {region: 0x166, script: 0x5b, flags: 0x0},
+	825:  {region: 0x166, script: 0x5b, flags: 0x0},
+	826:  {region: 0x9d, script: 0x5, flags: 0x0},
+	827:  {region: 0x166, script: 0x5b, flags: 0x0},
+	828:  {region: 0x166, script: 0x5b, flags: 0x0},
+	829:  {region: 0x166, script: 0x5b, flags: 0x0},
+	830:  {region: 0xde, script: 0x5b, flags: 0x0},
+	831:  {region: 0x166, script: 0x5b, flags: 0x0},
+	832:  {region: 0x166, script: 0x5b, flags: 0x0},
+	834:  {region: 0x166, script: 0x5b, flags: 0x0},
+	835:  {region: 0x53, script: 0x3b, flags: 0x0},
+	836:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	837:  {region: 0xd3, script: 0x5b, flags: 0x0},
+	838:  {region: 0x166, script: 0x5b, flags: 0x0},
+	839:  {region: 0xdb, script: 0x5b, flags: 0x0},
+	840:  {region: 0x166, script: 0x5b, flags: 0x0},
+	841:  {region: 0x166, script: 0x5b, flags: 0x0},
+	842:  {region: 0x166, script: 0x5b, flags: 0x0},
+	843:  {region: 0xd0, script: 0x5b, flags: 0x0},
+	844:  {region: 0x166, script: 0x5b, flags: 0x0},
+	845:  {region: 0x166, script: 0x5b, flags: 0x0},
+	846:  {region: 0x165, script: 0x5b, flags: 0x0},
+	847:  {region: 0xd2, script: 0x5b, flags: 0x0},
+	848:  {region: 0x61, script: 0x5b, flags: 0x0},
+	849:  {region: 0xdc, script: 0x22, flags: 0x0},
+	850:  {region: 0x166, script: 0x5b, flags: 0x0},
+	851:  {region: 0xdc, script: 0x22, flags: 0x0},
+	852:  {region: 0x166, script: 0x5b, flags: 0x0},
+	853:  {region: 0x166, script: 0x5b, flags: 0x0},
+	854:  {region: 0xd3, script: 0x5b, flags: 0x0},
+	855:  {region: 0x166, script: 0x5b, flags: 0x0},
+	856:  {region: 0x166, script: 0x5b, flags: 0x0},
+	857:  {region: 0xd2, script: 0x5b, flags: 0x0},
+	858:  {region: 0x166, script: 0x5b, flags: 0x0},
+	859:  {region: 0xd0, script: 0x5b, flags: 0x0},
+	860:  {region: 0xd0, script: 0x5b, flags: 0x0},
+	861:  {region: 0x166, script: 0x5b, flags: 0x0},
+	862:  {region: 0x166, script: 0x5b, flags: 0x0},
+	863:  {region: 0x96, script: 0x5b, flags: 0x0},
+	864:  {region: 0x166, script: 0x5b, flags: 0x0},
+	865:  {region: 0xe0, script: 0x5b, flags: 0x0},
+	866:  {region: 0x166, script: 0x5b, flags: 0x0},
+	867:  {region: 0x166, script: 0x5b, flags: 0x0},
+	868:  {region: 0x9a, script: 0x5b, flags: 0x0},
+	869:  {region: 0x166, script: 0x5b, flags: 0x0},
+	870:  {region: 0x166, script: 0x5b, flags: 0x0},
+	871:  {region: 0xda, script: 0x5b, flags: 0x0},
+	872:  {region: 0x52, script: 0x5b, flags: 0x0},
+	873:  {region: 0x166, script: 0x5b, flags: 0x0},
+	874:  {region: 0xdb, script: 0x5b, flags: 0x0},
+	875:  {region: 0x166, script: 0x5b, flags: 0x0},
+	876:  {region: 0x52, script: 0x5b, flags: 0x0},
+	877:  {region: 0x166, script: 0x5b, flags: 0x0},
+	878:  {region: 0x166, script: 0x5b, flags: 0x0},
+	879:  {region: 0xdb, script: 0x5b, flags: 0x0},
+	880:  {region: 0x124, script: 0x57, flags: 0x0},
+	881:  {region: 0x9a, script: 0x22, flags: 0x0},
+	882:  {region: 0x10d, script: 0xcb, flags: 0x0},
+	883:  {region: 0x166, script: 0x5b, flags: 0x0},
+	884:  {region: 0x166, script: 0x5b, flags: 0x0},
+	885:  {region: 0x85, script: 0x7e, flags: 0x0},
+	886:  {region: 0x162, script: 0x5b, flags: 0x0},
+	887:  {region: 0x166, script: 0x5b, flags: 0x0},
+	888:  {region: 0x49, script: 0x17, flags: 0x0},
+	889:  {region: 0x166, script: 0x5b, flags: 0x0},
+	890:  {region: 0x162, script: 0x5b, flags: 0x0},
+	891:  {region: 0x166, script: 0x5b, flags: 0x0},
+	892:  {region: 0x166, script: 0x5b, flags: 0x0},
+	893:  {region: 0x166, script: 0x5b, flags: 0x0},
+	894:  {region: 0x166, script: 0x5b, flags: 0x0},
+	895:  {region: 0x166, script: 0x5b, flags: 0x0},
+	896:  {region: 0x118, script: 0x5b, flags: 0x0},
+	897:  {region: 0x166, script: 0x5b, flags: 0x0},
+	898:  {region: 0x166, script: 0x5b, flags: 0x0},
+	899:  {region: 0x136, script: 0x5b, flags: 0x0},
+	900:  {region: 0x166, script: 0x5b, flags: 0x0},
+	901:  {region: 0x53, script: 0x5b, flags: 0x0},
+	902:  {region: 0x166, script: 0x5b, flags: 0x0},
+	903:  {region: 0xcf, script: 0x5b, flags: 0x0},
+	904:  {region: 0x130, script: 0x5b, flags: 0x0},
+	905:  {region: 0x132, script: 0x5b, flags: 0x0},
+	906:  {region: 0x81, script: 0x5b, flags: 0x0},
+	907:  {region: 0x79, script: 0x5b, flags: 0x0},
+	908:  {region: 0x166, script: 0x5b, flags: 0x0},
+	910:  {region: 0x166, script: 0x5b, flags: 0x0},
+	911:  {region: 0x166, script: 0x5b, flags: 0x0},
+	912:  {region: 0x70, script: 0x5b, flags: 0x0},
+	913:  {region: 0x166, script: 0x5b, flags: 0x0},
+	914:  {region: 0x166, script: 0x5b, flags: 0x0},
+	915:  {region: 0x166, script: 0x5b, flags: 0x0},
+	916:  {region: 0x166, script: 0x5b, flags: 0x0},
+	917:  {region: 0x9a, script: 0x83, flags: 0x0},
+	918:  {region: 0x166, script: 0x5b, flags: 0x0},
+	919:  {region: 0x166, script: 0x5, flags: 0x0},
+	920:  {region: 0x7e, script: 0x20, flags: 0x0},
+	921:  {region: 0x136, script: 0x84, flags: 0x0},
+	922:  {region: 0x166, script: 0x5, flags: 0x0},
+	923:  {region: 0xc6, script: 0x82, flags: 0x0},
+	924:  {region: 0x166, script: 0x5b, flags: 0x0},
+	925:  {region: 0x2c, script: 0x3, flags: 0x1},
+	926:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	927:  {region: 0x2f, script: 0x2, flags: 0x1},
+	928:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	929:  {region: 0x30, script: 0x5b, flags: 0x0},
+	930:  {region: 0xf1, script: 0x5b, flags: 0x0},
+	931:  {region: 0x166, script: 0x5b, flags: 0x0},
+	932:  {region: 0x79, script: 0x5b, flags: 0x0},
+	933:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	934:  {region: 0x136, script: 0x5b, flags: 0x0},
+	935:  {region: 0x49, script: 0x5b, flags: 0x0},
+	936:  {region: 0x166, script: 0x5b, flags: 0x0},
+	937:  {region: 0x9d, script: 0xfa, flags: 0x0},
+	938:  {region: 0x166, script: 0x5b, flags: 0x0},
+	939:  {region: 0x61, script: 0x5b, flags: 0x0},
+	940:  {region: 0x166, script: 0x5, flags: 0x0},
+	941:  {region: 0xb1, script: 0x90, flags: 0x0},
+	943:  {region: 0x166, script: 0x5b, flags: 0x0},
+	944:  {region: 0x166, script: 0x5b, flags: 0x0},
+	945:  {region: 0x9a, script: 0x12, flags: 0x0},
+	946:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	947:  {region: 0xea, script: 0x5b, flags: 0x0},
+	948:  {region: 0x166, script: 0x5b, flags: 0x0},
+	949:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	950:  {region: 0x166, script: 0x5b, flags: 0x0},
+	951:  {region: 0x166, script: 0x5b, flags: 0x0},
+	952:  {region: 0x88, script: 0x34, flags: 0x0},
+	953:  {region: 0x76, script: 0x5b, flags: 0x0},
+	954:  {region: 0x166, script: 0x5b, flags: 0x0},
+	955:  {region: 0xe9, script: 0x4e, flags: 0x0},
+	956:  {region: 0x9d, script: 0x5, flags: 0x0},
+	957:  {region: 0x1, script: 0x5b, flags: 0x0},
+	958:  {region: 0x24, script: 0x5, flags: 0x0},
+	959:  {region: 0x166, script: 0x5b, flags: 0x0},
+	960:  {region: 0x41, script: 0x5b, flags: 0x0},
+	961:  {region: 0x166, script: 0x5b, flags: 0x0},
+	962:  {region: 0x7b, script: 0x5b, flags: 0x0},
+	963:  {region: 0x166, script: 0x5b, flags: 0x0},
+	964:  {region: 0xe5, script: 0x5b, flags: 0x0},
+	965:  {region: 0x8a, script: 0x5b, flags: 0x0},
+	966:  {region: 0x6a, script: 0x5b, flags: 0x0},
+	967:  {region: 0x166, script: 0x5b, flags: 0x0},
+	968:  {region: 0x9a, script: 0x22, flags: 0x0},
+	969:  {region: 0x166, script: 0x5b, flags: 0x0},
+	970:  {region: 0x103, script: 0x5b, flags: 0x0},
+	971:  {region: 0x96, script: 0x5b, flags: 0x0},
+	972:  {region: 0x166, script: 0x5b, flags: 0x0},
+	973:  {region: 0x166, script: 0x5b, flags: 0x0},
+	974:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	975:  {region: 0x166, script: 0x5, flags: 0x0},
+	976:  {region: 0x9a, script: 0x5b, flags: 0x0},
+	977:  {region: 0x31, script: 0x2, flags: 0x1},
+	978:  {region: 0xdc, script: 0x22, flags: 0x0},
+	979:  {region: 0x35, script: 0xe, flags: 0x0},
+	980:  {region: 0x4e, script: 0x5b, flags: 0x0},
+	981:  {region: 0x73, script: 0x5b, flags: 0x0},
+	982:  {region: 0x4e, script: 0x5b, flags: 0x0},
+	983:  {region: 0x9d, script: 0x5, flags: 0x0},
+	984:  {region: 0x10d, script: 0x5b, flags: 0x0},
+	985:  {region: 0x3a, script: 0x5b, flags: 0x0},
+	986:  {region: 0x166, script: 0x5b, flags: 0x0},
+	987:  {region: 0xd2, script: 0x5b, flags: 0x0},
+	988:  {region: 0x105, script: 0x5b, flags: 0x0},
+	989:  {region: 0x96, script: 0x5b, flags: 0x0},
+	990:  {region: 0x130, script: 0x5b, flags: 0x0},
+	991:  {region: 0x166, script: 0x5b, flags: 0x0},
+	992:  {region: 0x166, script: 0x5b, flags: 0x0},
+	993:  {region: 0x74, script: 0x5b, flags: 0x0},
+	994:  {region: 0x107, script: 0x20, flags: 0x0},
+	995:  {region: 0x131, script: 0x20, flags: 0x0},
+	996:  {region: 0x10a, script: 0x5b, flags: 0x0},
+	997:  {region: 0x108, script: 0x5b, flags: 0x0},
+	998:  {region: 0x130, script: 0x5b, flags: 0x0},
+	999:  {region: 0x166, script: 0x5b, flags: 0x0},
+	1000: {region: 0xa3, script: 0x4c, flags: 0x0},
+	1001: {region: 0x9a, script: 0x22, flags: 0x0},
+	1002: {region: 0x81, script: 0x5b, flags: 0x0},
+	1003: {region: 0x107, script: 0x20, flags: 0x0},
+	1004: {region: 0xa5, script: 0x5b, flags: 0x0},
+	1005: {region: 0x96, script: 0x5b, flags: 0x0},
+	1006: {region: 0x9a, script: 0x5b, flags: 0x0},
+	1007: {region: 0x115, script: 0x5b, flags: 0x0},
+	1008: {region: 0x9a, script: 0xcf, flags: 0x0},
+	1009: {region: 0x166, script: 0x5b, flags: 0x0},
+	1010: {region: 0x166, script: 0x5b, flags: 0x0},
+	1011: {region: 0x130, script: 0x5b, flags: 0x0},
+	1012: {region: 0x9f, script: 0x5b, flags: 0x0},
+	1013: {region: 0x9a, script: 0x22, flags: 0x0},
+	1014: {region: 0x166, script: 0x5, flags: 0x0},
+	1015: {region: 0x9f, script: 0x5b, flags: 0x0},
+	1016: {region: 0x7c, script: 0x5b, flags: 0x0},
+	1017: {region: 0x49, script: 0x5b, flags: 0x0},
+	1018: {region: 0x33, script: 0x4, flags: 0x1},
+	1019: {region: 0x9f, script: 0x5b, flags: 0x0},
+	1020: {region: 0x9d, script: 0x5, flags: 0x0},
+	1021: {region: 0xdb, script: 0x5b, flags: 0x0},
+	1022: {region: 0x4f, script: 0x5b, flags: 0x0},
+	1023: {region: 0xd2, script: 0x5b, flags: 0x0},
+	1024: {region: 0xd0, script: 0x5b, flags: 0x0},
+	1025: {region: 0xc4, script: 0x5b, flags: 0x0},
+	1026: {region: 0x4c, script: 0x5b, flags: 0x0},
+	1027: {region: 0x97, script: 0x80, flags: 0x0},
+	1028: {region: 0xb7, script: 0x5b, flags: 0x0},
+	1029: {region: 0x166, script: 0x2c, flags: 0x0},
+	1030: {region: 0x166, script: 0x5b, flags: 0x0},
+	1032: {region: 0xbb, script: 0xeb, flags: 0x0},
+	1033: {region: 0x166, script: 0x5b, flags: 0x0},
+	1034: {region: 0xc5, script: 0x76, flags: 0x0},
+	1035: {region: 0x166, script: 0x5, flags: 0x0},
+	1036: {region: 0xb4, script: 0xd6, flags: 0x0},
+	1037: {region: 0x70, script: 0x5b, flags: 0x0},
+	1038: {region: 0x166, script: 0x5b, flags: 0x0},
+	1039: {region: 0x166, script: 0x5b, flags: 0x0},
+	1040: {region: 0x166, script: 0x5b, flags: 0x0},
+	1041: {region: 0x166, script: 0x5b, flags: 0x0},
+	1042: {region: 0x112, script: 0x5b, flags: 0x0},
+	1043: {region: 0x166, script: 0x5b, flags: 0x0},
+	1044: {region: 0xe9, script: 0x5, flags: 0x0},
+	1045: {region: 0x166, script: 0x5b, flags: 0x0},
+	1046: {region: 0x110, script: 0x5b, flags: 0x0},
+	1047: {region: 0x166, script: 0x5b, flags: 0x0},
+	1048: {region: 0xea, script: 0x5b, flags: 0x0},
+	1049: {region: 0x166, script: 0x5b, flags: 0x0},
+	1050: {region: 0x96, script: 0x5b, flags: 0x0},
+	1051: {region: 0x143, script: 0x5b, flags: 0x0},
+	1052: {region: 0x10d, script: 0x5b, flags: 0x0},
+	1054: {region: 0x10d, script: 0x5b, flags: 0x0},
+	1055: {region: 0x73, script: 0x5b, flags: 0x0},
+	1056: {region: 0x98, script: 0xcc, flags: 0x0},
+	1057: {region: 0x166, script: 0x5b, flags: 0x0},
+	1058: {region: 0x73, script: 0x5b, flags: 0x0},
+	1059: {region: 0x165, script: 0x5b, flags: 0x0},
+	1060: {region: 0x166, script: 0x5b, flags: 0x0},
+	1061: {region: 0xc4, script: 0x5b, flags: 0x0},
+	1062: {region: 0x166, script: 0x5b, flags: 0x0},
+	1063: {region: 0x166, script: 0x5b, flags: 0x0},
+	1064: {region: 0x166, script: 0x5b, flags: 0x0},
+	1065: {region: 0x116, script: 0x5b, flags: 0x0},
+	1066: {region: 0x166, script: 0x5b, flags: 0x0},
+	1067: {region: 0x166, script: 0x5b, flags: 0x0},
+	1068: {region: 0x124, script: 0xee, flags: 0x0},
+	1069: {region: 0x166, script: 0x5b, flags: 0x0},
+	1070: {region: 0x166, script: 0x5b, flags: 0x0},
+	1071: {region: 0x166, script: 0x5b, flags: 0x0},
+	1072: {region: 0x166, script: 0x5b, flags: 0x0},
+	1073: {region: 0x27, script: 0x5b, flags: 0x0},
+	1074: {region: 0x37, script: 0x5, flags: 0x1},
+	1075: {region: 0x9a, script: 0xd9, flags: 0x0},
+	1076: {region: 0x117, script: 0x5b, flags: 0x0},
+	1077: {region: 0x115, script: 0x5b, flags: 0x0},
+	1078: {region: 0x9a, script: 0x22, flags: 0x0},
+	1079: {region: 0x162, script: 0x5b, flags: 0x0},
+	1080: {region: 0x166, script: 0x5b, flags: 0x0},
+	1081: {region: 0x166, script: 0x5b, flags: 0x0},
+	1082: {region: 0x6e, script: 0x5b, flags: 0x0},
+	1083: {region: 0x162, script: 0x5b, flags: 0x0},
+	1084: {region: 0x166, script: 0x5b, flags: 0x0},
+	1085: {region: 0x61, script: 0x5b, flags: 0x0},
+	1086: {region: 0x96, script: 0x5b, flags: 0x0},
+	1087: {region: 0x166, script: 0x5b, flags: 0x0},
+	1088: {region: 0x166, script: 0x5b, flags: 0x0},
+	1089: {region: 0x130, script: 0x5b, flags: 0x0},
+	1090: {region: 0x166, script: 0x5b, flags: 0x0},
+	1091: {region: 0x85, script: 0x5b, flags: 0x0},
+	1092: {region: 0x10d, script: 0x5b, flags: 0x0},
+	1093: {region: 0x130, script: 0x5b, flags: 0x0},
+	1094: {region: 0x160, script: 0x5, flags: 0x0},
+	1095: {region: 0x4b, script: 0x5b, flags: 0x0},
+	1096: {region: 0x61, script: 0x5b, flags: 0x0},
+	1097: {region: 0x166, script: 0x5b, flags: 0x0},
+	1098: {region: 0x9a, script: 0x22, flags: 0x0},
+	1099: {region: 0x96, script: 0x5b, flags: 0x0},
+	1100: {region: 0x166, script: 0x5b, flags: 0x0},
+	1101: {region: 0x35, script: 0xe, flags: 0x0},
+	1102: {region: 0x9c, script: 0xde, flags: 0x0},
+	1103: {region: 0xea, script: 0x5b, flags: 0x0},
+	1104: {region: 0x9a, script: 0xe6, flags: 0x0},
+	1105: {region: 0xdc, script: 0x22, flags: 0x0},
+	1106: {region: 0x166, script: 0x5b, flags: 0x0},
+	1107: {region: 0x166, script: 0x5b, flags: 0x0},
+	1108: {region: 0x166, script: 0x5b, flags: 0x0},
+	1109: {region: 0x166, script: 0x5b, flags: 0x0},
+	1110: {region: 0x166, script: 0x5b, flags: 0x0},
+	1111: {region: 0x166, script: 0x5b, flags: 0x0},
+	1112: {region: 0x166, script: 0x5b, flags: 0x0},
+	1113: {region: 0x166, script: 0x5b, flags: 0x0},
+	1114: {region: 0xe8, script: 0x5b, flags: 0x0},
+	1115: {region: 0x166, script: 0x5b, flags: 0x0},
+	1116: {region: 0x166, script: 0x5b, flags: 0x0},
+	1117: {region: 0x9a, script: 0x53, flags: 0x0},
+	1118: {region: 0x53, script: 0xe4, flags: 0x0},
+	1119: {region: 0xdc, script: 0x22, flags: 0x0},
+	1120: {region: 0xdc, script: 0x22, flags: 0x0},
+	1121: {region: 0x9a, script: 0xe9, flags: 0x0},
+	1122: {region: 0x166, script: 0x5b, flags: 0x0},
+	1123: {region: 0x113, script: 0x5b, flags: 0x0},
+	1124: {region: 0x132, script: 0x5b, flags: 0x0},
+	1125: {region: 0x127, script: 0x5b, flags: 0x0},
+	1126: {region: 0x166, script: 0x5b, flags: 0x0},
+	1127: {region: 0x3c, script: 0x3, flags: 0x1},
+	1128: {region: 0x166, script: 0x5b, flags: 0x0},
+	1129: {region: 0x166, script: 0x5b, flags: 0x0},
+	1130: {region: 0x166, script: 0x5b, flags: 0x0},
+	1131: {region: 0x124, script: 0xee, flags: 0x0},
+	1132: {region: 0xdc, script: 0x22, flags: 0x0},
+	1133: {region: 0xdc, script: 0x22, flags: 0x0},
+	1134: {region: 0xdc, script: 0x22, flags: 0x0},
+	1135: {region: 0x70, script: 0x2c, flags: 0x0},
+	1136: {region: 0x166, script: 0x5b, flags: 0x0},
+	1137: {region: 0x6e, script: 0x2c, flags: 0x0},
+	1138: {region: 0x166, script: 0x5b, flags: 0x0},
+	1139: {region: 0x166, script: 0x5b, flags: 0x0},
+	1140: {region: 0x166, script: 0x5b, flags: 0x0},
+	1141: {region: 0xd7, script: 0x5b, flags: 0x0},
+	1142: {region: 0x128, script: 0x5b, flags: 0x0},
+	1143: {region: 0x126, script: 0x5b, flags: 0x0},
+	1144: {region: 0x32, script: 0x5b, flags: 0x0},
+	1145: {region: 0xdc, script: 0x22, flags: 0x0},
+	1146: {region: 0xe8, script: 0x5b, flags: 0x0},
+	1147: {region: 0x166, script: 0x5b, flags: 0x0},
+	1148: {region: 0x166, script: 0x5b, flags: 0x0},
+	1149: {region: 0x32, script: 0x5b, flags: 0x0},
+	1150: {region: 0xd5, script: 0x5b, flags: 0x0},
+	1151: {region: 0x166, script: 0x5b, flags: 0x0},
+	1152: {region: 0x162, script: 0x5b, flags: 0x0},
+	1153: {region: 0x166, script: 0x5b, flags: 0x0},
+	1154: {region: 0x12a, script: 0x5b, flags: 0x0},
+	1155: {region: 0x166, script: 0x5b, flags: 0x0},
+	1156: {region: 0xcf, script: 0x5b, flags: 0x0},
+	1157: {region: 0x166, script: 0x5b, flags: 0x0},
+	1158: {region: 0xe7, script: 0x5b, flags: 0x0},
+	1159: {region: 0x166, script: 0x5b, flags: 0x0},
+	1160: {region: 0x166, script: 0x5b, flags: 0x0},
+	1161: {region: 0x166, script: 0x5b, flags: 0x0},
+	1162: {region: 0x12c, script: 0x5b, flags: 0x0},
+	1163: {region: 0x12c, script: 0x5b, flags: 0x0},
+	1164: {region: 0x12f, script: 0x5b, flags: 0x0},
+	1165: {region: 0x166, script: 0x5, flags: 0x0},
+	1166: {region: 0x162, script: 0x5b, flags: 0x0},
+	1167: {region: 0x88, script: 0x34, flags: 0x0},
+	1168: {region: 0xdc, script: 0x22, flags: 0x0},
+	1169: {region: 0xe8, script: 0x5b, flags: 0x0},
+	1170: {region: 0x43, script: 0xef, flags: 0x0},
+	1171: {region: 0x166, script: 0x5b, flags: 0x0},
+	1172: {region: 0x107, script: 0x20, flags: 0x0},
+	1173: {region: 0x166, script: 0x5b, flags: 0x0},
+	1174: {region: 0x166, script: 0x5b, flags: 0x0},
+	1175: {region: 0x132, script: 0x5b, flags: 0x0},
+	1176: {region: 0x166, script: 0x5b, flags: 0x0},
+	1177: {region: 0x124, script: 0xee, flags: 0x0},
+	1178: {region: 0x32, script: 0x5b, flags: 0x0},
+	1179: {region: 0x166, script: 0x5b, flags: 0x0},
+	1180: {region: 0x166, script: 0x5b, flags: 0x0},
+	1181: {region: 0xcf, script: 0x5b, flags: 0x0},
+	1182: {region: 0x166, script: 0x5b, flags: 0x0},
+	1183: {region: 0x166, script: 0x5b, flags: 0x0},
+	1184: {region: 0x12e, script: 0x5b, flags: 0x0},
+	1185: {region: 0x166, script: 0x5b, flags: 0x0},
+	1187: {region: 0x166, script: 0x5b, flags: 0x0},
+	1188: {region: 0xd5, script: 0x5b, flags: 0x0},
+	1189: {region: 0x53, script: 0xe7, flags: 0x0},
+	1190: {region: 0xe6, script: 0x5b, flags: 0x0},
+	1191: {region: 0x166, script: 0x5b, flags: 0x0},
+	1192: {region: 0x107, script: 0x20, flags: 0x0},
+	1193: {region: 0xbb, script: 0x5b, flags: 0x0},
+	1194: {region: 0x166, script: 0x5b, flags: 0x0},
+	1195: {region: 0x107, script: 0x20, flags: 0x0},
+	1196: {region: 0x3f, script: 0x4, flags: 0x1},
+	1197: {region: 0x11d, script: 0xf3, flags: 0x0},
+	1198: {region: 0x131, script: 0x20, flags: 0x0},
+	1199: {region: 0x76, script: 0x5b, flags: 0x0},
+	1200: {region: 0x2a, script: 0x5b, flags: 0x0},
+	1202: {region: 0x43, script: 0x3, flags: 0x1},
+	1203: {region: 0x9a, script: 0xe, flags: 0x0},
+	1204: {region: 0xe9, script: 0x5, flags: 0x0},
+	1205: {region: 0x166, script: 0x5b, flags: 0x0},
+	1206: {region: 0x166, script: 0x5b, flags: 0x0},
+	1207: {region: 0x166, script: 0x5b, flags: 0x0},
+	1208: {region: 0x166, script: 0x5b, flags: 0x0},
+	1209: {region: 0x166, script: 0x5b, flags: 0x0},
+	1210: {region: 0x166, script: 0x5b, flags: 0x0},
+	1211: {region: 0x166, script: 0x5b, flags: 0x0},
+	1212: {region: 0x46, script: 0x4, flags: 0x1},
+	1213: {region: 0x166, script: 0x5b, flags: 0x0},
+	1214: {region: 0xb5, script: 0xf4, flags: 0x0},
+	1215: {region: 0x166, script: 0x5b, flags: 0x0},
+	1216: {region: 0x162, script: 0x5b, flags: 0x0},
+	1217: {region: 0x9f, script: 0x5b, flags: 0x0},
+	1218: {region: 0x107, script: 0x5b, flags: 0x0},
+	1219: {region: 0x13f, script: 0x5b, flags: 0x0},
+	1220: {region: 0x11c, script: 0x5b, flags: 0x0},
+	1221: {region: 0x166, script: 0x5b, flags: 0x0},
+	1222: {region: 0x36, script: 0x5b, flags: 0x0},
+	1223: {region: 0x61, script: 0x5b, flags: 0x0},
+	1224: {region: 0xd2, script: 0x5b, flags: 0x0},
+	1225: {region: 0x1, script: 0x5b, flags: 0x0},
+	1226: {region: 0x107, script: 0x5b, flags: 0x0},
+	1227: {region: 0x6b, script: 0x5b, flags: 0x0},
+	1228: {region: 0x130, script: 0x5b, flags: 0x0},
+	1229: {region: 0x166, script: 0x5b, flags: 0x0},
+	1230: {region: 0x36, script: 0x5b, flags: 0x0},
+	1231: {region: 0x4e, script: 0x5b, flags: 0x0},
+	1232: {region: 0x166, script: 0x5b, flags: 0x0},
+	1233: {region: 0x70, script: 0x2c, flags: 0x0},
+	1234: {region: 0x166, script: 0x5b, flags: 0x0},
+	1235: {region: 0xe8, script: 0x5b, flags: 0x0},
+	1236: {region: 0x2f, script: 0x5b, flags: 0x0},
+	1237: {region: 0x9a, script: 0xe9, flags: 0x0},
+	1238: {region: 0x9a, script: 0x22, flags: 0x0},
+	1239: {region: 0x166, script: 0x5b, flags: 0x0},
+	1240: {region: 0x166, script: 0x5b, flags: 0x0},
+	1241: {region: 0x166, script: 0x5b, flags: 0x0},
+	1242: {region: 0x166, script: 0x5b, flags: 0x0},
+	1243: {region: 0x166, script: 0x5b, flags: 0x0},
+	1244: {region: 0x166, script: 0x5b, flags: 0x0},
+	1245: {region: 0x166, script: 0x5b, flags: 0x0},
+	1246: {region: 0x166, script: 0x5b, flags: 0x0},
+	1247: {region: 0x166, script: 0x5b, flags: 0x0},
+	1248: {region: 0x141, script: 0x5b, flags: 0x0},
+	1249: {region: 0x166, script: 0x5b, flags: 0x0},
+	1250: {region: 0x166, script: 0x5b, flags: 0x0},
+	1251: {region: 0xa9, script: 0x5, flags: 0x0},
+	1252: {region: 0x166, script: 0x5b, flags: 0x0},
+	1253: {region: 0x115, script: 0x5b, flags: 0x0},
+	1254: {region: 0x166, script: 0x5b, flags: 0x0},
+	1255: {region: 0x166, script: 0x5b, flags: 0x0},
+	1256: {region: 0x166, script: 0x5b, flags: 0x0},
+	1257: {region: 0x166, script: 0x5b, flags: 0x0},
+	1258: {region: 0x9a, script: 0x22, flags: 0x0},
+	1259: {region: 0x53, script: 0x3b, flags: 0x0},
+	1260: {region: 0x166, script: 0x5b, flags: 0x0},
+	1261: {region: 0x166, script: 0x5b, flags: 0x0},
+	1262: {region: 0x41, script: 0x5b, flags: 0x0},
+	1263: {region: 0x166, script: 0x5b, flags: 0x0},
+	1264: {region: 0x12c, script: 0x18, flags: 0x0},
+	1265: {region: 0x166, script: 0x5b, flags: 0x0},
+	1266: {region: 0x162, script: 0x5b, flags: 0x0},
+	1267: {region: 0x166, script: 0x5b, flags: 0x0},
+	1268: {region: 0x12c, script: 0x63, flags: 0x0},
+	1269: {region: 0x12c, script: 0x64, flags: 0x0},
+	1270: {region: 0x7e, script: 0x2e, flags: 0x0},
+	1271: {region: 0x53, script: 0x68, flags: 0x0},
+	1272: {region: 0x10c, script: 0x6d, flags: 0x0},
+	1273: {region: 0x109, script: 0x79, flags: 0x0},
+	1274: {region: 0x9a, script: 0x22, flags: 0x0},
+	1275: {region: 0x132, script: 0x5b, flags: 0x0},
+	1276: {region: 0x166, script: 0x5b, flags: 0x0},
+	1277: {region: 0x9d, script: 0x93, flags: 0x0},
+	1278: {region: 0x166, script: 0x5b, flags: 0x0},
+	1279: {region: 0x15f, script: 0xce, flags: 0x0},
+	1280: {region: 0x166, script: 0x5b, flags: 0x0},
+	1281: {region: 0x166, script: 0x5b, flags: 0x0},
+	1282: {region: 0xdc, script: 0x22, flags: 0x0},
+	1283: {region: 0x166, script: 0x5b, flags: 0x0},
+	1284: {region: 0x166, script: 0x5b, flags: 0x0},
+	1285: {region: 0xd2, script: 0x5b, flags: 0x0},
+	1286: {region: 0x76, script: 0x5b, flags: 0x0},
+	1287: {region: 0x166, script: 0x5b, flags: 0x0},
+	1288: {region: 0x166, script: 0x5b, flags: 0x0},
+	1289: {region: 0x52, script: 0x5b, flags: 0x0},
+	1290: {region: 0x166, script: 0x5b, flags: 0x0},
+	1291: {region: 0x166, script: 0x5b, flags: 0x0},
+	1292: {region: 0x166, script: 0x5b, flags: 0x0},
+	1293: {region: 0x52, script: 0x5b, flags: 0x0},
+	1294: {region: 0x166, script: 0x5b, flags: 0x0},
+	1295: {region: 0x166, script: 0x5b, flags: 0x0},
+	1296: {region: 0x166, script: 0x5b, flags: 0x0},
+	1297: {region: 0x166, script: 0x5b, flags: 0x0},
+	1298: {region: 0x1, script: 0x3e, flags: 0x0},
+	1299: {region: 0x166, script: 0x5b, flags: 0x0},
+	1300: {region: 0x166, script: 0x5b, flags: 0x0},
+	1301: {region: 0x166, script: 0x5b, flags: 0x0},
+	1302: {region: 0x166, script: 0x5b, flags: 0x0},
+	1303: {region: 0x166, script: 0x5b, flags: 0x0},
+	1304: {region: 0xd7, script: 0x5b, flags: 0x0},
+	1305: {region: 0x166, script: 0x5b, flags: 0x0},
+	1306: {region: 0x166, script: 0x5b, flags: 0x0},
+	1307: {region: 0x166, script: 0x5b, flags: 0x0},
+	1308: {region: 0x41, script: 0x5b, flags: 0x0},
+	1309: {region: 0x166, script: 0x5b, flags: 0x0},
+	1310: {region: 0xd0, script: 0x5b, flags: 0x0},
+	1311: {region: 0x4a, script: 0x3, flags: 0x1},
+	1312: {region: 0x166, script: 0x5b, flags: 0x0},
+	1313: {region: 0x166, script: 0x5b, flags: 0x0},
+	1314: {region: 0x166, script: 0x5b, flags: 0x0},
+	1315: {region: 0x53, script: 0x5b, flags: 0x0},
+	1316: {region: 0x10c, script: 0x5b, flags: 0x0},
+	1318: {region: 0xa9, script: 0x5, flags: 0x0},
+	1319: {region: 0xda, script: 0x5b, flags: 0x0},
+	1320: {region: 0xbb, script: 0xeb, flags: 0x0},
+	1321: {region: 0x4d, script: 0x14, flags: 0x1},
+	1322: {region: 0x53, script: 0x7f, flags: 0x0},
+	1323: {region: 0x166, script: 0x5b, flags: 0x0},
+	1324: {region: 0x123, script: 0x5b, flags: 0x0},
+	1325: {region: 0xd1, script: 0x5b, flags: 0x0},
+	1326: {region: 0x166, script: 0x5b, flags: 0x0},
+	1327: {region: 0x162, script: 0x5b, flags: 0x0},
+	1329: {region: 0x12c, script: 0x5b, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 582 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+	0:  {region: 0x9d, script: 0x7, flags: 0x0},
+	1:  {region: 0xa2, script: 0x7a, flags: 0x2},
+	2:  {region: 0x11d, script: 0x87, flags: 0x2},
+	3:  {region: 0x32, script: 0x5b, flags: 0x0},
+	4:  {region: 0x9c, script: 0x5, flags: 0x4},
+	5:  {region: 0x9d, script: 0x5, flags: 0x4},
+	6:  {region: 0x107, script: 0x20, flags: 0x4},
+	7:  {region: 0x9d, script: 0x5, flags: 0x2},
+	8:  {region: 0x107, script: 0x20, flags: 0x0},
+	9:  {region: 0x38, script: 0x2f, flags: 0x2},
+	10: {region: 0x136, script: 0x5b, flags: 0x0},
+	11: {region: 0x7c, script: 0xd1, flags: 0x2},
+	12: {region: 0x115, script: 0x5b, flags: 0x0},
+	13: {region: 0x85, script: 0x1, flags: 0x2},
+	14: {region: 0x5e, script: 0x1f, flags: 0x0},
+	15: {region: 0x88, script: 0x60, flags: 0x2},
+	16: {region: 0xd7, script: 0x5b, flags: 0x0},
+	17: {region: 0x52, script: 0x5, flags: 0x4},
+	18: {region: 0x10c, script: 0x5, flags: 0x4},
+	19: {region: 0xaf, script: 0x20, flags: 0x0},
+	20: {region: 0x24, script: 0x5, flags: 0x4},
+	21: {region: 0x53, script: 0x5, flags: 0x4},
+	22: {region: 0x9d, script: 0x5, flags: 0x4},
+	23: {region: 0xc6, script: 0x5, flags: 0x4},
+	24: {region: 0x53, script: 0x5, flags: 0x2},
+	25: {region: 0x12c, script: 0x5b, flags: 0x0},
+	26: {region: 0xb1, script: 0x5, flags: 0x4},
+	27: {region: 0x9c, script: 0x5, flags: 0x2},
+	28: {region: 0xa6, script: 0x20, flags: 0x0},
+	29: {region: 0x53, script: 0x5, flags: 0x4},
+	30: {region: 0x12c, script: 0x5b, flags: 0x4},
+	31: {region: 0x53, script: 0x5, flags: 0x2},
+	32: {region: 0x12c, script: 0x5b, flags: 0x2},
+	33: {region: 0xdc, script: 0x22, flags: 0x0},
+	34: {region: 0x9a, script: 0x5e, flags: 0x2},
+	35: {region: 0x84, script: 0x5b, flags: 0x0},
+	36: {region: 0x85, script: 0x7e, flags: 0x4},
+	37: {region: 0x85, script: 0x7e, flags: 0x2},
+	38: {region: 0xc6, script: 0x20, flags: 0x0},
+	39: {region: 0x53, script: 0x71, flags: 0x4},
+	40: {region: 0x53, script: 0x71, flags: 0x2},
+	41: {region: 0xd1, script: 0x5b, flags: 0x0},
+	42: {region: 0x4a, script: 0x5, flags: 0x4},
+	43: {region: 0x96, script: 0x5, flags: 0x4},
+	44: {region: 0x9a, script: 0x36, flags: 0x0},
+	45: {region: 0xe9, script: 0x5, flags: 0x4},
+	46: {region: 0xe9, script: 0x5, flags: 0x2},
+	47: {region: 0x9d, script: 0x8d, flags: 0x0},
+	48: {region: 0x53, script: 0x8e, flags: 0x2},
+	49: {region: 0xbb, script: 0xeb, flags: 0x0},
+	50: {region: 0xda, script: 0x5b, flags: 0x4},
+	51: {region: 0xe9, script: 0x5, flags: 0x0},
+	52: {region: 0x9a, script: 0x22, flags: 0x2},
+	53: {region: 0x9a, script: 0x50, flags: 0x2},
+	54: {region: 0x9a, script: 0xd5, flags: 0x2},
+	55: {region: 0x106, script: 0x20, flags: 0x0},
+	56: {region: 0xbe, script: 0x5b, flags: 0x4},
+	57: {region: 0x105, script: 0x5b, flags: 0x4},
+	58: {region: 0x107, script: 0x5b, flags: 0x4},
+	59: {region: 0x12c, script: 0x5b, flags: 0x4},
+	60: {region: 0x125, script: 0x20, flags: 0x0},
+	61: {region: 0xe9, script: 0x5, flags: 0x4},
+	62: {region: 0xe9, script: 0x5, flags: 0x2},
+	63: {region: 0x53, script: 0x5, flags: 0x0},
+	64: {region: 0xaf, script: 0x20, flags: 0x4},
+	65: {region: 0xc6, script: 0x20, flags: 0x4},
+	66: {region: 0xaf, script: 0x20, flags: 0x2},
+	67: {region: 0x9a, script: 0xe, flags: 0x0},
+	68: {region: 0xdc, script: 0x22, flags: 0x4},
+	69: {region: 0xdc, script: 0x22, flags: 0x2},
+	70: {region: 0x138, script: 0x5b, flags: 0x0},
+	71: {region: 0x24, script: 0x5, flags: 0x4},
+	72: {region: 0x53, script: 0x20, flags: 0x4},
+	73: {region: 0x24, script: 0x5, flags: 0x2},
+	74: {region: 0x8e, script: 0x3c, flags: 0x0},
+	75: {region: 0x53, script: 0x3b, flags: 0x4},
+	76: {region: 0x53, script: 0x3b, flags: 0x2},
+	77: {region: 0x53, script: 0x3b, flags: 0x0},
+	78: {region: 0x2f, script: 0x3c, flags: 0x4},
+	79: {region: 0x3e, script: 0x3c, flags: 0x4},
+	80: {region: 0x7c, script: 0x3c, flags: 0x4},
+	81: {region: 0x7f, script: 0x3c, flags: 0x4},
+	82: {region: 0x8e, script: 0x3c, flags: 0x4},
+	83: {region: 0x96, script: 0x3c, flags: 0x4},
+	84: {region: 0xc7, script: 0x3c, flags: 0x4},
+	85: {region: 0xd1, script: 0x3c, flags: 0x4},
+	86: {region: 0xe3, script: 0x3c, flags: 0x4},
+	87: {region: 0xe6, script: 0x3c, flags: 0x4},
+	88: {region: 0xe8, script: 0x3c, flags: 0x4},
+	89: {region: 0x117, script: 0x3c, flags: 0x4},
+	90: {region: 0x124, script: 0x3c, flags: 0x4},
+	91: {region: 0x12f, script: 0x3c, flags: 0x4},
+	92: {region: 0x136, script: 0x3c, flags: 0x4},
+	93: {region: 0x13f, script: 0x3c, flags: 0x4},
+	94: {region: 0x12f, script: 0x11, flags: 0x2},
+	95: {region: 0x12f, script: 0x37, flags: 0x2},
+	96: {region: 0x12f, script: 0x3c, flags: 0x2},
+}
+
+type likelyLangScript struct {
+	lang   uint16
+	script uint16
+	flags  uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 2154 bytes, 359 elements
+var likelyRegion = [359]likelyLangScript{
+	34:  {lang: 0xd7, script: 0x5b, flags: 0x0},
+	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
+	36:  {lang: 0x0, script: 0x2, flags: 0x1},
+	39:  {lang: 0x2, script: 0x2, flags: 0x1},
+	40:  {lang: 0x4, script: 0x2, flags: 0x1},
+	42:  {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	43:  {lang: 0x0, script: 0x5b, flags: 0x0},
+	44:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	45:  {lang: 0x41b, script: 0x5b, flags: 0x0},
+	46:  {lang: 0x10d, script: 0x5b, flags: 0x0},
+	48:  {lang: 0x367, script: 0x5b, flags: 0x0},
+	49:  {lang: 0x444, script: 0x5b, flags: 0x0},
+	50:  {lang: 0x58, script: 0x5b, flags: 0x0},
+	51:  {lang: 0x6, script: 0x2, flags: 0x1},
+	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
+	54:  {lang: 0x367, script: 0x5b, flags: 0x0},
+	55:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	56:  {lang: 0x7e, script: 0x20, flags: 0x0},
+	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
+	58:  {lang: 0x3d9, script: 0x5b, flags: 0x0},
+	59:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	60:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	62:  {lang: 0x31f, script: 0x5b, flags: 0x0},
+	63:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	64:  {lang: 0x3a1, script: 0x5b, flags: 0x0},
+	65:  {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	67:  {lang: 0x8, script: 0x2, flags: 0x1},
+	69:  {lang: 0x0, script: 0x5b, flags: 0x0},
+	71:  {lang: 0x71, script: 0x20, flags: 0x0},
+	73:  {lang: 0x512, script: 0x3e, flags: 0x2},
+	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
+	75:  {lang: 0x445, script: 0x5b, flags: 0x0},
+	76:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	77:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	78:  {lang: 0x10d, script: 0x5b, flags: 0x0},
+	79:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	81:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	82:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	83:  {lang: 0xa, script: 0x4, flags: 0x1},
+	84:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	85:  {lang: 0x0, script: 0x5b, flags: 0x0},
+	87:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	90:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	91:  {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	92:  {lang: 0x3a1, script: 0x5b, flags: 0x0},
+	94:  {lang: 0xe, script: 0x2, flags: 0x1},
+	95:  {lang: 0xfa, script: 0x5b, flags: 0x0},
+	97:  {lang: 0x10d, script: 0x5b, flags: 0x0},
+	99:  {lang: 0x1, script: 0x5b, flags: 0x0},
+	100: {lang: 0x101, script: 0x5b, flags: 0x0},
+	102: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	104: {lang: 0x10, script: 0x2, flags: 0x1},
+	105: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	106: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	107: {lang: 0x140, script: 0x5b, flags: 0x0},
+	108: {lang: 0x3a, script: 0x5, flags: 0x0},
+	109: {lang: 0x3a, script: 0x5, flags: 0x0},
+	110: {lang: 0x46f, script: 0x2c, flags: 0x0},
+	111: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	112: {lang: 0x12, script: 0x2, flags: 0x1},
+	114: {lang: 0x10d, script: 0x5b, flags: 0x0},
+	115: {lang: 0x151, script: 0x5b, flags: 0x0},
+	116: {lang: 0x1c0, script: 0x22, flags: 0x2},
+	119: {lang: 0x158, script: 0x5b, flags: 0x0},
+	121: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	123: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	124: {lang: 0x14, script: 0x2, flags: 0x1},
+	126: {lang: 0x16, script: 0x3, flags: 0x1},
+	127: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	129: {lang: 0x21, script: 0x5b, flags: 0x0},
+	131: {lang: 0x245, script: 0x5b, flags: 0x0},
+	133: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	134: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	135: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	136: {lang: 0x19, script: 0x2, flags: 0x1},
+	137: {lang: 0x0, script: 0x5b, flags: 0x0},
+	138: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	140: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	142: {lang: 0x529, script: 0x3c, flags: 0x0},
+	143: {lang: 0x0, script: 0x5b, flags: 0x0},
+	144: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	145: {lang: 0x1d1, script: 0x5b, flags: 0x0},
+	146: {lang: 0x1d4, script: 0x5b, flags: 0x0},
+	147: {lang: 0x1d5, script: 0x5b, flags: 0x0},
+	149: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	150: {lang: 0x1b, script: 0x2, flags: 0x1},
+	152: {lang: 0x1bc, script: 0x3e, flags: 0x0},
+	154: {lang: 0x1d, script: 0x3, flags: 0x1},
+	156: {lang: 0x3a, script: 0x5, flags: 0x0},
+	157: {lang: 0x20, script: 0x2, flags: 0x1},
+	158: {lang: 0x1f8, script: 0x5b, flags: 0x0},
+	159: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+	162: {lang: 0x3a, script: 0x5, flags: 0x0},
+	163: {lang: 0x200, script: 0x49, flags: 0x0},
+	165: {lang: 0x445, script: 0x5b, flags: 0x0},
+	166: {lang: 0x28a, script: 0x20, flags: 0x0},
+	167: {lang: 0x22, script: 0x3, flags: 0x1},
+	169: {lang: 0x25, script: 0x2, flags: 0x1},
+	171: {lang: 0x254, script: 0x54, flags: 0x0},
+	172: {lang: 0x254, script: 0x54, flags: 0x0},
+	173: {lang: 0x3a, script: 0x5, flags: 0x0},
+	175: {lang: 0x3e2, script: 0x20, flags: 0x0},
+	176: {lang: 0x27, script: 0x2, flags: 0x1},
+	177: {lang: 0x3a, script: 0x5, flags: 0x0},
+	179: {lang: 0x10d, script: 0x5b, flags: 0x0},
+	180: {lang: 0x40c, script: 0xd6, flags: 0x0},
+	182: {lang: 0x43b, script: 0x5b, flags: 0x0},
+	183: {lang: 0x2c0, script: 0x5b, flags: 0x0},
+	184: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	185: {lang: 0x2c7, script: 0x5b, flags: 0x0},
+	186: {lang: 0x3a, script: 0x5, flags: 0x0},
+	187: {lang: 0x29, script: 0x2, flags: 0x1},
+	188: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	189: {lang: 0x2b, script: 0x2, flags: 0x1},
+	190: {lang: 0x432, script: 0x5b, flags: 0x0},
+	191: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	192: {lang: 0x2f1, script: 0x5b, flags: 0x0},
+	195: {lang: 0x2d, script: 0x2, flags: 0x1},
+	196: {lang: 0xa0, script: 0x5b, flags: 0x0},
+	197: {lang: 0x2f, script: 0x2, flags: 0x1},
+	198: {lang: 0x31, script: 0x2, flags: 0x1},
+	199: {lang: 0x33, script: 0x2, flags: 0x1},
+	201: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	202: {lang: 0x35, script: 0x2, flags: 0x1},
+	204: {lang: 0x320, script: 0x5b, flags: 0x0},
+	205: {lang: 0x37, script: 0x3, flags: 0x1},
+	206: {lang: 0x128, script: 0xed, flags: 0x0},
+	208: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	209: {lang: 0x31f, script: 0x5b, flags: 0x0},
+	210: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	211: {lang: 0x16, script: 0x5b, flags: 0x0},
+	212: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	213: {lang: 0x1b4, script: 0x5b, flags: 0x0},
+	215: {lang: 0x1b4, script: 0x5, flags: 0x2},
+	217: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	218: {lang: 0x367, script: 0x5b, flags: 0x0},
+	219: {lang: 0x347, script: 0x5b, flags: 0x0},
+	220: {lang: 0x351, script: 0x22, flags: 0x0},
+	226: {lang: 0x3a, script: 0x5, flags: 0x0},
+	227: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	229: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	230: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	231: {lang: 0x486, script: 0x5b, flags: 0x0},
+	232: {lang: 0x153, script: 0x5b, flags: 0x0},
+	233: {lang: 0x3a, script: 0x3, flags: 0x1},
+	234: {lang: 0x3b3, script: 0x5b, flags: 0x0},
+	235: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	237: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	238: {lang: 0x3a, script: 0x5, flags: 0x0},
+	239: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	241: {lang: 0x3a2, script: 0x5b, flags: 0x0},
+	242: {lang: 0x194, script: 0x5b, flags: 0x0},
+	244: {lang: 0x3a, script: 0x5, flags: 0x0},
+	259: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	261: {lang: 0x3d, script: 0x2, flags: 0x1},
+	262: {lang: 0x432, script: 0x20, flags: 0x0},
+	263: {lang: 0x3f, script: 0x2, flags: 0x1},
+	264: {lang: 0x3e5, script: 0x5b, flags: 0x0},
+	265: {lang: 0x3a, script: 0x5, flags: 0x0},
+	267: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	268: {lang: 0x3a, script: 0x5, flags: 0x0},
+	269: {lang: 0x41, script: 0x2, flags: 0x1},
+	272: {lang: 0x416, script: 0x5b, flags: 0x0},
+	273: {lang: 0x347, script: 0x5b, flags: 0x0},
+	274: {lang: 0x43, script: 0x2, flags: 0x1},
+	276: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+	277: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	278: {lang: 0x429, script: 0x5b, flags: 0x0},
+	279: {lang: 0x367, script: 0x5b, flags: 0x0},
+	281: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	283: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	285: {lang: 0x45, script: 0x2, flags: 0x1},
+	289: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	290: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	291: {lang: 0x47, script: 0x2, flags: 0x1},
+	292: {lang: 0x49, script: 0x3, flags: 0x1},
+	293: {lang: 0x4c, script: 0x2, flags: 0x1},
+	294: {lang: 0x477, script: 0x5b, flags: 0x0},
+	295: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	296: {lang: 0x476, script: 0x5b, flags: 0x0},
+	297: {lang: 0x4e, script: 0x2, flags: 0x1},
+	298: {lang: 0x482, script: 0x5b, flags: 0x0},
+	300: {lang: 0x50, script: 0x4, flags: 0x1},
+	302: {lang: 0x4a0, script: 0x5b, flags: 0x0},
+	303: {lang: 0x54, script: 0x2, flags: 0x1},
+	304: {lang: 0x445, script: 0x5b, flags: 0x0},
+	305: {lang: 0x56, script: 0x3, flags: 0x1},
+	306: {lang: 0x445, script: 0x5b, flags: 0x0},
+	310: {lang: 0x512, script: 0x3e, flags: 0x2},
+	311: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	312: {lang: 0x4bc, script: 0x5b, flags: 0x0},
+	313: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+	316: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	319: {lang: 0x4c3, script: 0x5b, flags: 0x0},
+	320: {lang: 0x8a, script: 0x5b, flags: 0x0},
+	321: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	323: {lang: 0x41b, script: 0x5b, flags: 0x0},
+	334: {lang: 0x59, script: 0x2, flags: 0x1},
+	351: {lang: 0x3a, script: 0x5, flags: 0x0},
+	352: {lang: 0x5b, script: 0x2, flags: 0x1},
+	357: {lang: 0x423, script: 0x5b, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 558 bytes, 93 elements
+var likelyRegionList = [93]likelyLangScript{
+	0:  {lang: 0x148, script: 0x5, flags: 0x0},
+	1:  {lang: 0x476, script: 0x5b, flags: 0x0},
+	2:  {lang: 0x431, script: 0x5b, flags: 0x0},
+	3:  {lang: 0x2ff, script: 0x20, flags: 0x0},
+	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
+	5:  {lang: 0x274, script: 0x5b, flags: 0x0},
+	6:  {lang: 0xb7, script: 0x5b, flags: 0x0},
+	7:  {lang: 0x432, script: 0x20, flags: 0x0},
+	8:  {lang: 0x12d, script: 0xef, flags: 0x0},
+	9:  {lang: 0x351, script: 0x22, flags: 0x0},
+	10: {lang: 0x529, script: 0x3b, flags: 0x0},
+	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
+	12: {lang: 0x523, script: 0x5b, flags: 0x0},
+	13: {lang: 0x29a, script: 0xee, flags: 0x0},
+	14: {lang: 0x136, script: 0x34, flags: 0x0},
+	15: {lang: 0x48a, script: 0x5b, flags: 0x0},
+	16: {lang: 0x3a, script: 0x5, flags: 0x0},
+	17: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	18: {lang: 0x27, script: 0x2c, flags: 0x0},
+	19: {lang: 0x139, script: 0x5b, flags: 0x0},
+	20: {lang: 0x26a, script: 0x5, flags: 0x2},
+	21: {lang: 0x512, script: 0x3e, flags: 0x2},
+	22: {lang: 0x210, script: 0x2e, flags: 0x0},
+	23: {lang: 0x5, script: 0x20, flags: 0x0},
+	24: {lang: 0x274, script: 0x5b, flags: 0x0},
+	25: {lang: 0x136, script: 0x34, flags: 0x0},
+	26: {lang: 0x2ff, script: 0x20, flags: 0x0},
+	27: {lang: 0x1e1, script: 0x5b, flags: 0x0},
+	28: {lang: 0x31f, script: 0x5, flags: 0x0},
+	29: {lang: 0x1be, script: 0x22, flags: 0x0},
+	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	31: {lang: 0x236, script: 0x76, flags: 0x0},
+	32: {lang: 0x148, script: 0x5, flags: 0x0},
+	33: {lang: 0x476, script: 0x5b, flags: 0x0},
+	34: {lang: 0x24a, script: 0x4f, flags: 0x0},
+	35: {lang: 0xe6, script: 0x5, flags: 0x0},
+	36: {lang: 0x226, script: 0xee, flags: 0x0},
+	37: {lang: 0x3a, script: 0x5, flags: 0x0},
+	38: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	39: {lang: 0x2b8, script: 0x58, flags: 0x0},
+	40: {lang: 0x226, script: 0xee, flags: 0x0},
+	41: {lang: 0x3a, script: 0x5, flags: 0x0},
+	42: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	43: {lang: 0x3dc, script: 0x5b, flags: 0x0},
+	44: {lang: 0x4ae, script: 0x20, flags: 0x0},
+	45: {lang: 0x2ff, script: 0x20, flags: 0x0},
+	46: {lang: 0x431, script: 0x5b, flags: 0x0},
+	47: {lang: 0x331, script: 0x76, flags: 0x0},
+	48: {lang: 0x213, script: 0x5b, flags: 0x0},
+	49: {lang: 0x30b, script: 0x20, flags: 0x0},
+	50: {lang: 0x242, script: 0x5, flags: 0x0},
+	51: {lang: 0x529, script: 0x3c, flags: 0x0},
+	52: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	53: {lang: 0x3a, script: 0x5, flags: 0x0},
+	54: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	55: {lang: 0x2ed, script: 0x5b, flags: 0x0},
+	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	57: {lang: 0x88, script: 0x22, flags: 0x0},
+	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	60: {lang: 0xbe, script: 0x22, flags: 0x0},
+	61: {lang: 0x3dc, script: 0x5b, flags: 0x0},
+	62: {lang: 0x7e, script: 0x20, flags: 0x0},
+	63: {lang: 0x3e2, script: 0x20, flags: 0x0},
+	64: {lang: 0x267, script: 0x5b, flags: 0x0},
+	65: {lang: 0x444, script: 0x5b, flags: 0x0},
+	66: {lang: 0x512, script: 0x3e, flags: 0x0},
+	67: {lang: 0x412, script: 0x5b, flags: 0x0},
+	68: {lang: 0x4ae, script: 0x20, flags: 0x0},
+	69: {lang: 0x3a, script: 0x5, flags: 0x0},
+	70: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	71: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	72: {lang: 0x35, script: 0x5, flags: 0x0},
+	73: {lang: 0x46b, script: 0xee, flags: 0x0},
+	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
+	75: {lang: 0x30f, script: 0x76, flags: 0x0},
+	76: {lang: 0x467, script: 0x20, flags: 0x0},
+	77: {lang: 0x148, script: 0x5, flags: 0x0},
+	78: {lang: 0x3a, script: 0x5, flags: 0x0},
+	79: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	80: {lang: 0x48a, script: 0x5b, flags: 0x0},
+	81: {lang: 0x58, script: 0x5, flags: 0x0},
+	82: {lang: 0x219, script: 0x20, flags: 0x0},
+	83: {lang: 0x81, script: 0x34, flags: 0x0},
+	84: {lang: 0x529, script: 0x3c, flags: 0x0},
+	85: {lang: 0x48c, script: 0x5b, flags: 0x0},
+	86: {lang: 0x4ae, script: 0x20, flags: 0x0},
+	87: {lang: 0x512, script: 0x3e, flags: 0x0},
+	88: {lang: 0x3b3, script: 0x5b, flags: 0x0},
+	89: {lang: 0x431, script: 0x5b, flags: 0x0},
+	90: {lang: 0x432, script: 0x20, flags: 0x0},
+	91: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	92: {lang: 0x446, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+	lang   uint16
+	region uint16
+	script uint16
+}
+
+// Size: 198 bytes, 33 elements
+var likelyRegionGroup = [33]likelyTag{
+	1:  {lang: 0x139, region: 0xd7, script: 0x5b},
+	2:  {lang: 0x139, region: 0x136, script: 0x5b},
+	3:  {lang: 0x3c0, region: 0x41, script: 0x5b},
+	4:  {lang: 0x139, region: 0x2f, script: 0x5b},
+	5:  {lang: 0x139, region: 0xd7, script: 0x5b},
+	6:  {lang: 0x13e, region: 0xd0, script: 0x5b},
+	7:  {lang: 0x445, region: 0x130, script: 0x5b},
+	8:  {lang: 0x3a, region: 0x6c, script: 0x5},
+	9:  {lang: 0x445, region: 0x4b, script: 0x5b},
+	10: {lang: 0x139, region: 0x162, script: 0x5b},
+	11: {lang: 0x139, region: 0x136, script: 0x5b},
+	12: {lang: 0x139, region: 0x136, script: 0x5b},
+	13: {lang: 0x13e, region: 0x5a, script: 0x5b},
+	14: {lang: 0x529, region: 0x53, script: 0x3b},
+	15: {lang: 0x1be, region: 0x9a, script: 0x22},
+	16: {lang: 0x1e1, region: 0x96, script: 0x5b},
+	17: {lang: 0x1f9, region: 0x9f, script: 0x5b},
+	18: {lang: 0x139, region: 0x2f, script: 0x5b},
+	19: {lang: 0x139, region: 0xe7, script: 0x5b},
+	20: {lang: 0x139, region: 0x8b, script: 0x5b},
+	21: {lang: 0x41b, region: 0x143, script: 0x5b},
+	22: {lang: 0x529, region: 0x53, script: 0x3b},
+	23: {lang: 0x4bc, region: 0x138, script: 0x5b},
+	24: {lang: 0x3a, region: 0x109, script: 0x5},
+	25: {lang: 0x3e2, region: 0x107, script: 0x20},
+	26: {lang: 0x3e2, region: 0x107, script: 0x20},
+	27: {lang: 0x139, region: 0x7c, script: 0x5b},
+	28: {lang: 0x10d, region: 0x61, script: 0x5b},
+	29: {lang: 0x139, region: 0xd7, script: 0x5b},
+	30: {lang: 0x13e, region: 0x1f, script: 0x5b},
+	31: {lang: 0x139, region: 0x9b, script: 0x5b},
+	32: {lang: 0x139, region: 0x7c, script: 0x5b},
+}
+
+// Size: 264 bytes, 33 elements
+var regionContainment = [33]uint64{
+	// Entry 0 - 1F
+	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
+	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
+	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
+	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
+	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
+	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
+	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
+	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
+	// Entry 20 - 3F
+	0x0000000100000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 359 bytes, 359 elements
+var regionInclusion = [359]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
+	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
+	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
+	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
+	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
+	// Entry 40 - 7F
+	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
+	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
+	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34,
+	0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e,
+	0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21,
+	0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a,
+	0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c,
+	0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28,
+	// Entry 80 - BF
+	0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27,
+	0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22,
+	0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38,
+	0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a,
+	0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31,
+	0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d,
+	0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38,
+	0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26,
+	// Entry C0 - FF
+	0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36,
+	0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f,
+	0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d,
+	0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24,
+	0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b,
+	0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a,
+	0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+	// Entry 100 - 13F
+	0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33,
+	0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d,
+	0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28,
+	0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22,
+	0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31,
+	0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36,
+	0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28,
+	0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31,
+	// Entry 140 - 17F
+	0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24,
+	0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings.  These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 584 bytes, 73 elements
+var regionInclusionBits = [73]uint64{
+	// Entry 0 - 1F
+	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
+	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
+	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
+	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
+	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
+	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
+	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
+	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
+	// Entry 20 - 3F
+	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
+	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
+	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
+	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
+	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
+	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
+	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
+	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
+	// Entry 40 - 5F
+	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
+	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
+	0x0000000102020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 73 bytes, 73 elements
+var regionInclusionNext = [73]uint8{
+	// Entry 0 - 3F
+	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
+	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
+	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
+	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
+	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
+	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
+	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
+	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
+	// Entry 40 - 7F
+	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
+	0x43,
+}
+
+type parentRel struct {
+	lang       uint16
+	script     uint16
+	maxScript  uint16
+	toRegion   uint16
+	fromRegion []uint16
+}
+
+// Size: 414 bytes, 5 elements
+var parents = [5]parentRel{
+	0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}},
+	1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}},
+	2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}},
+	3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}},
+	4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}},
+}
+
+// Total table size 30466 bytes (29KiB); checksum: 7544152B
diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go
new file mode 100644
index 0000000..e7afd31
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tags.go
@@ -0,0 +1,48 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+	t, err := Parse(s)
+	if err != nil {
+		panic(err)
+	}
+	return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Language {
+	b, err := ParseBase(s)
+	if err != nil {
+		panic(err)
+	}
+	return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+	scr, err := ParseScript(s)
+	if err != nil {
+		panic(err)
+	}
+	return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+	r, err := ParseRegion(s)
+	if err != nil {
+		panic(err)
+	}
+	return r
+}
+
+// Und is the root language.
+var Und Tag
diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go
new file mode 100644
index 0000000..1cc004a
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/match.go
@@ -0,0 +1,67 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package internal
+
+// This file contains matchers that implement CLDR inheritance.
+//
+//     See https://unicode.org/reports/tr35/#Locale_Inheritance.
+//
+// Some of the inheritance described in this document is already handled by
+// the cldr package.
+
+import (
+	"golang.org/x/text/language"
+)
+
+// TODO: consider if (some of the) matching algorithm needs to be public after
+// getting some feel about what is generic and what is specific.
+
+// NewInheritanceMatcher returns a matcher that matches based on the inheritance
+// chain.
+//
+// The matcher uses canonicalization and the parent relationship to find a
+// match. The resulting match will always be either Und or a language with the
+// same language and script as the requested language. It will not match
+// languages for which there is understood to be mutual or one-directional
+// intelligibility.
+//
+// A Match will indicate an Exact match if the language matches after
+// canonicalization and High if the matched tag is a parent.
+func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher {
+	tags := &InheritanceMatcher{make(map[language.Tag]int)}
+	for i, tag := range t {
+		ct, err := language.All.Canonicalize(tag)
+		if err != nil {
+			ct = tag
+		}
+		tags.index[ct] = i
+	}
+	return tags
+}
+
+type InheritanceMatcher struct {
+	index map[language.Tag]int
+}
+
+func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) {
+	for _, t := range want {
+		ct, err := language.All.Canonicalize(t)
+		if err != nil {
+			ct = t
+		}
+		conf := language.Exact
+		for {
+			if index, ok := m.index[ct]; ok {
+				return ct, index, conf
+			}
+			if ct == language.Und {
+				break
+			}
+			ct = ct.Parent()
+			conf = language.High
+		}
+	}
+	return language.Und, 0, language.No
+}
diff --git a/vendor/golang.org/x/text/internal/number/common.go b/vendor/golang.org/x/text/internal/number/common.go
new file mode 100644
index 0000000..a6e9c8e
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/number/common.go
@@ -0,0 +1,55 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package number
+
+import (
+	"unicode/utf8"
+
+	"golang.org/x/text/internal/language/compact"
+)
+
+// A system identifies a CLDR numbering system.
+type system byte
+
+type systemData struct {
+	id        system
+	digitSize byte              // number of UTF-8 bytes per digit
+	zero      [utf8.UTFMax]byte // UTF-8 sequence of zero digit.
+}
+
+// A SymbolType identifies a symbol of a specific kind.
+type SymbolType int
+
+const (
+	SymDecimal SymbolType = iota
+	SymGroup
+	SymList
+	SymPercentSign
+	SymPlusSign
+	SymMinusSign
+	SymExponential
+	SymSuperscriptingExponent
+	SymPerMille
+	SymInfinity
+	SymNan
+	SymTimeSeparator
+
+	NumSymbolTypes
+)
+
+const hasNonLatnMask = 0x8000
+
+// symOffset is an offset into altSymData if the bit indicated by hasNonLatnMask
+// is not 0 (with this bit masked out), and an offset into symIndex otherwise.
+//
+// TODO: this type can be a byte again if we use an indirection into altsymData
+// and introduce an alt -> offset slice (the length of this will be number of
+// alternatives plus 1). This also allows getting rid of the compactTag field
+// in altSymData. In total this will save about 1K.
+type symOffset uint16
+
+type altSymData struct {
+	compactTag compact.ID
+	symIndex   symOffset
+	system     system
+}
diff --git a/vendor/golang.org/x/text/internal/number/decimal.go b/vendor/golang.org/x/text/internal/number/decimal.go
new file mode 100644
index 0000000..e128cf3
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/number/decimal.go
@@ -0,0 +1,500 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate stringer -type RoundingMode
+
+package number
+
+import (
+	"math"
+	"strconv"
+)
+
+// RoundingMode determines how a number is rounded to the desired precision.
+type RoundingMode byte
+
+const (
+	ToNearestEven RoundingMode = iota // towards the nearest integer, or towards an even number if equidistant.
+	ToNearestZero                     // towards the nearest integer, or towards zero if equidistant.
+	ToNearestAway                     // towards the nearest integer, or away from zero if equidistant.
+	ToPositiveInf                     // towards infinity
+	ToNegativeInf                     // towards negative infinity
+	ToZero                            // towards zero
+	AwayFromZero                      // away from zero
+	numModes
+)
+
+const maxIntDigits = 20
+
+// A Decimal represents a floating point number in decimal format.
+// Digits represents a number [0, 1.0), and the absolute value represented by
+// Decimal is Digits * 10^Exp. Leading and trailing zeros may be omitted and Exp
+// may point outside a valid position in Digits.
+//
+// Examples:
+//
+//	Number     Decimal
+//	12345      Digits: [1, 2, 3, 4, 5], Exp: 5
+//	12.345     Digits: [1, 2, 3, 4, 5], Exp: 2
+//	12000      Digits: [1, 2],          Exp: 5
+//	12000.00   Digits: [1, 2],          Exp: 5
+//	0.00123    Digits: [1, 2, 3],       Exp: -2
+//	0          Digits: [],              Exp: 0
+type Decimal struct {
+	digits
+
+	buf [maxIntDigits]byte
+}
+
+type digits struct {
+	Digits []byte // mantissa digits, big-endian
+	Exp    int32  // exponent
+	Neg    bool
+	Inf    bool // Takes precedence over Digits and Exp.
+	NaN    bool // Takes precedence over Inf.
+}
+
+// Digits represents a floating point number represented in digits of the
+// base in which a number is to be displayed. It is similar to Decimal, but
+// keeps track of trailing fraction zeros and the comma placement for
+// engineering notation. Digits must have at least one digit.
+//
+// Examples:
+//
+//	  Number     Decimal
+//	decimal
+//	  12345      Digits: [1, 2, 3, 4, 5], Exp: 5  End: 5
+//	  12.345     Digits: [1, 2, 3, 4, 5], Exp: 2  End: 5
+//	  12000      Digits: [1, 2],          Exp: 5  End: 5
+//	  12000.00   Digits: [1, 2],          Exp: 5  End: 7
+//	  0.00123    Digits: [1, 2, 3],       Exp: -2 End: 3
+//	  0          Digits: [],              Exp: 0  End: 1
+//	scientific (actual exp is Exp - Comma)
+//	  0e0        Digits: [0],             Exp: 1, End: 1, Comma: 1
+//	  .0e0       Digits: [0],             Exp: 0, End: 1, Comma: 0
+//	  0.0e0      Digits: [0],             Exp: 1, End: 2, Comma: 1
+//	  1.23e4     Digits: [1, 2, 3],       Exp: 5, End: 3, Comma: 1
+//	  .123e5     Digits: [1, 2, 3],       Exp: 5, End: 3, Comma: 0
+//	engineering
+//	  12.3e3     Digits: [1, 2, 3],       Exp: 5, End: 3, Comma: 2
+type Digits struct {
+	digits
+	// End indicates the end position of the number.
+	End int32 // For decimals Exp <= End. For scientific len(Digits) <= End.
+	// Comma is used for the comma position for scientific (always 0 or 1) and
+	// engineering notation (always 0, 1, 2, or 3).
+	Comma uint8
+	// IsScientific indicates whether this number is to be rendered as a
+	// scientific number.
+	IsScientific bool
+}
+
+func (d *Digits) NumFracDigits() int {
+	if d.Exp >= d.End {
+		return 0
+	}
+	return int(d.End - d.Exp)
+}
+
+// normalize returns a new Decimal with leading and trailing zeros removed.
+func (d *Decimal) normalize() (n Decimal) {
+	n = *d
+	b := n.Digits
+	// Strip leading zeros. Resulting number of digits is significant digits.
+	for len(b) > 0 && b[0] == 0 {
+		b = b[1:]
+		n.Exp--
+	}
+	// Strip trailing zeros
+	for len(b) > 0 && b[len(b)-1] == 0 {
+		b = b[:len(b)-1]
+	}
+	if len(b) == 0 {
+		n.Exp = 0
+	}
+	n.Digits = b
+	return n
+}
+
+func (d *Decimal) clear() {
+	b := d.Digits
+	if b == nil {
+		b = d.buf[:0]
+	}
+	*d = Decimal{}
+	d.Digits = b[:0]
+}
+
+func (x *Decimal) String() string {
+	if x.NaN {
+		return "NaN"
+	}
+	var buf []byte
+	if x.Neg {
+		buf = append(buf, '-')
+	}
+	if x.Inf {
+		buf = append(buf, "Inf"...)
+		return string(buf)
+	}
+	switch {
+	case len(x.Digits) == 0:
+		buf = append(buf, '0')
+	case x.Exp <= 0:
+		// 0.00ddd
+		buf = append(buf, "0."...)
+		buf = appendZeros(buf, -int(x.Exp))
+		buf = appendDigits(buf, x.Digits)
+
+	case /* 0 < */ int(x.Exp) < len(x.Digits):
+		// dd.ddd
+		buf = appendDigits(buf, x.Digits[:x.Exp])
+		buf = append(buf, '.')
+		buf = appendDigits(buf, x.Digits[x.Exp:])
+
+	default: // len(x.Digits) <= x.Exp
+		// ddd00
+		buf = appendDigits(buf, x.Digits)
+		buf = appendZeros(buf, int(x.Exp)-len(x.Digits))
+	}
+	return string(buf)
+}
+
+func appendDigits(buf []byte, digits []byte) []byte {
+	for _, c := range digits {
+		buf = append(buf, c+'0')
+	}
+	return buf
+}
+
+// appendZeros appends n 0 digits to buf and returns buf.
+func appendZeros(buf []byte, n int) []byte {
+	for ; n > 0; n-- {
+		buf = append(buf, '0')
+	}
+	return buf
+}
+
+func (d *digits) round(mode RoundingMode, n int) {
+	if n >= len(d.Digits) {
+		return
+	}
+	// Make rounding decision: The result mantissa is truncated ("rounded down")
+	// by default. Decide if we need to increment, or "round up", the (unsigned)
+	// mantissa.
+	inc := false
+	switch mode {
+	case ToNegativeInf:
+		inc = d.Neg
+	case ToPositiveInf:
+		inc = !d.Neg
+	case ToZero:
+		// nothing to do
+	case AwayFromZero:
+		inc = true
+	case ToNearestEven:
+		inc = d.Digits[n] > 5 || d.Digits[n] == 5 &&
+			(len(d.Digits) > n+1 || n == 0 || d.Digits[n-1]&1 != 0)
+	case ToNearestAway:
+		inc = d.Digits[n] >= 5
+	case ToNearestZero:
+		inc = d.Digits[n] > 5 || d.Digits[n] == 5 && len(d.Digits) > n+1
+	default:
+		panic("unreachable")
+	}
+	if inc {
+		d.roundUp(n)
+	} else {
+		d.roundDown(n)
+	}
+}
+
+// roundFloat rounds a floating point number.
+func (r RoundingMode) roundFloat(x float64) float64 {
+	// Make rounding decision: The result mantissa is truncated ("rounded down")
+	// by default. Decide if we need to increment, or "round up", the (unsigned)
+	// mantissa.
+	abs := x
+	if x < 0 {
+		abs = -x
+	}
+	i, f := math.Modf(abs)
+	if f == 0.0 {
+		return x
+	}
+	inc := false
+	switch r {
+	case ToNegativeInf:
+		inc = x < 0
+	case ToPositiveInf:
+		inc = x >= 0
+	case ToZero:
+		// nothing to do
+	case AwayFromZero:
+		inc = true
+	case ToNearestEven:
+		// TODO: check overflow
+		inc = f > 0.5 || f == 0.5 && int64(i)&1 != 0
+	case ToNearestAway:
+		inc = f >= 0.5
+	case ToNearestZero:
+		inc = f > 0.5
+	default:
+		panic("unreachable")
+	}
+	if inc {
+		i += 1
+	}
+	if abs != x {
+		i = -i
+	}
+	return i
+}
+
+func (x *digits) roundUp(n int) {
+	if n < 0 || n >= len(x.Digits) {
+		return // nothing to do
+	}
+	// find first digit < 9
+	for n > 0 && x.Digits[n-1] >= 9 {
+		n--
+	}
+
+	if n == 0 {
+		// all digits are 9s => round up to 1 and update exponent
+		x.Digits[0] = 1 // ok since len(x.Digits) > n
+		x.Digits = x.Digits[:1]
+		x.Exp++
+		return
+	}
+	x.Digits[n-1]++
+	x.Digits = x.Digits[:n]
+	// x already trimmed
+}
+
+func (x *digits) roundDown(n int) {
+	if n < 0 || n >= len(x.Digits) {
+		return // nothing to do
+	}
+	x.Digits = x.Digits[:n]
+	trim(x)
+}
+
+// trim cuts off any trailing zeros from x's mantissa;
+// they are meaningless for the value of x.
+func trim(x *digits) {
+	i := len(x.Digits)
+	for i > 0 && x.Digits[i-1] == 0 {
+		i--
+	}
+	x.Digits = x.Digits[:i]
+	if i == 0 {
+		x.Exp = 0
+	}
+}
+
+// A Converter converts a number into decimals according to the given rounding
+// criteria.
+type Converter interface {
+	Convert(d *Decimal, r RoundingContext)
+}
+
+const (
+	signed   = true
+	unsigned = false
+)
+
+// Convert converts the given number to the decimal representation using the
+// supplied RoundingContext.
+func (d *Decimal) Convert(r RoundingContext, number interface{}) {
+	switch f := number.(type) {
+	case Converter:
+		d.clear()
+		f.Convert(d, r)
+	case float32:
+		d.ConvertFloat(r, float64(f), 32)
+	case float64:
+		d.ConvertFloat(r, f, 64)
+	case int:
+		d.ConvertInt(r, signed, uint64(f))
+	case int8:
+		d.ConvertInt(r, signed, uint64(f))
+	case int16:
+		d.ConvertInt(r, signed, uint64(f))
+	case int32:
+		d.ConvertInt(r, signed, uint64(f))
+	case int64:
+		d.ConvertInt(r, signed, uint64(f))
+	case uint:
+		d.ConvertInt(r, unsigned, uint64(f))
+	case uint8:
+		d.ConvertInt(r, unsigned, uint64(f))
+	case uint16:
+		d.ConvertInt(r, unsigned, uint64(f))
+	case uint32:
+		d.ConvertInt(r, unsigned, uint64(f))
+	case uint64:
+		d.ConvertInt(r, unsigned, f)
+
+	default:
+		d.NaN = true
+		// TODO:
+		// case string: if produced by strconv, allows for easy arbitrary pos.
+		// case reflect.Value:
+		// case big.Float
+		// case big.Int
+		// case big.Rat?
+		// catch underlyings using reflect or will this already be done by the
+		//    message package?
+	}
+}
+
+// ConvertInt converts an integer to decimals.
+func (d *Decimal) ConvertInt(r RoundingContext, signed bool, x uint64) {
+	if r.Increment > 0 {
+		// TODO: if uint64 is too large, fall back to float64
+		if signed {
+			d.ConvertFloat(r, float64(int64(x)), 64)
+		} else {
+			d.ConvertFloat(r, float64(x), 64)
+		}
+		return
+	}
+	d.clear()
+	if signed && int64(x) < 0 {
+		x = uint64(-int64(x))
+		d.Neg = true
+	}
+	d.fillIntDigits(x)
+	d.Exp = int32(len(d.Digits))
+}
+
+// ConvertFloat converts a floating point number to decimals.
+func (d *Decimal) ConvertFloat(r RoundingContext, x float64, size int) {
+	d.clear()
+	if math.IsNaN(x) {
+		d.NaN = true
+		return
+	}
+	// Simple case: decimal notation
+	if r.Increment > 0 {
+		scale := int(r.IncrementScale)
+		mult := 1.0
+		if scale >= len(scales) {
+			mult = math.Pow(10, float64(scale))
+		} else {
+			mult = scales[scale]
+		}
+		// We multiply x instead of dividing inc as it gives less rounding
+		// issues.
+		x *= mult
+		x /= float64(r.Increment)
+		x = r.Mode.roundFloat(x)
+		x *= float64(r.Increment)
+		x /= mult
+	}
+
+	abs := x
+	if x < 0 {
+		d.Neg = true
+		abs = -x
+	}
+	if math.IsInf(abs, 1) {
+		d.Inf = true
+		return
+	}
+
+	// By default we get the exact decimal representation.
+	verb := byte('g')
+	prec := -1
+	// As the strconv API does not return the rounding accuracy, we can only
+	// round using ToNearestEven.
+	if r.Mode == ToNearestEven {
+		if n := r.RoundSignificantDigits(); n >= 0 {
+			prec = n
+		} else if n = r.RoundFractionDigits(); n >= 0 {
+			prec = n
+			verb = 'f'
+		}
+	} else {
+		// TODO: At this point strconv's rounding is imprecise to the point that
+		// it is not usable for this purpose.
+		// See https://github.com/golang/go/issues/21714
+		// If rounding is requested, we ask for a large number of digits and
+		// round from there to simulate rounding only once.
+		// Ideally we would have strconv export an AppendDigits that would take
+		// a rounding mode and/or return an accuracy. Something like this would
+		// work:
+		// AppendDigits(dst []byte, x float64, base, size, prec int) (digits []byte, exp, accuracy int)
+		hasPrec := r.RoundSignificantDigits() >= 0
+		hasScale := r.RoundFractionDigits() >= 0
+		if hasPrec || hasScale {
+			// prec is the number of mantissa bits plus some extra for safety.
+			// We need at least the number of mantissa bits as decimals to
+			// accurately represent the floating point without rounding, as each
+			// bit requires one more decimal to represent: 0.5, 0.25, 0.125, ...
+			prec = 60
+		}
+	}
+
+	b := strconv.AppendFloat(d.Digits[:0], abs, verb, prec, size)
+	i := 0
+	k := 0
+	beforeDot := 1
+	for i < len(b) {
+		if c := b[i]; '0' <= c && c <= '9' {
+			b[k] = c - '0'
+			k++
+			d.Exp += int32(beforeDot)
+		} else if c == '.' {
+			beforeDot = 0
+			d.Exp = int32(k)
+		} else {
+			break
+		}
+		i++
+	}
+	d.Digits = b[:k]
+	if i != len(b) {
+		i += len("e")
+		pSign := i
+		exp := 0
+		for i++; i < len(b); i++ {
+			exp *= 10
+			exp += int(b[i] - '0')
+		}
+		if b[pSign] == '-' {
+			exp = -exp
+		}
+		d.Exp = int32(exp) + 1
+	}
+}
+
+func (d *Decimal) fillIntDigits(x uint64) {
+	if cap(d.Digits) < maxIntDigits {
+		d.Digits = d.buf[:]
+	} else {
+		d.Digits = d.buf[:maxIntDigits]
+	}
+	i := 0
+	for ; x > 0; x /= 10 {
+		d.Digits[i] = byte(x % 10)
+		i++
+	}
+	d.Digits = d.Digits[:i]
+	for p := 0; p < i; p++ {
+		i--
+		d.Digits[p], d.Digits[i] = d.Digits[i], d.Digits[p]
+	}
+}
+
+var scales [70]float64
+
+func init() {
+	x := 1.0
+	for i := range scales {
+		scales[i] = x
+		x *= 10
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/number/format.go b/vendor/golang.org/x/text/internal/number/format.go
new file mode 100644
index 0000000..cd94c5d
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/number/format.go
@@ -0,0 +1,535 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package number
+
+import (
+	"strconv"
+	"unicode/utf8"
+
+	"golang.org/x/text/language"
+)
+
+// TODO:
+// - grouping of fractions
+// - allow user-defined superscript notation (such as <sup>4</sup>)
+// - same for non-breaking spaces, like &nbsp;
+
+// A VisibleDigits computes digits, comma placement and trailing zeros as they
+// will be shown to the user.
+type VisibleDigits interface {
+	Digits(buf []byte, t language.Tag, scale int) Digits
+	// TODO: Do we also need to add the verb or pass a format.State?
+}
+
+// Formatting proceeds along the following lines:
+// 0) Compose rounding information from format and context.
+// 1) Convert a number into a Decimal.
+// 2) Sanitize Decimal by adding trailing zeros, removing leading digits, and
+//    (non-increment) rounding. The Decimal that results from this is suitable
+//    for determining the plural form.
+// 3) Render the Decimal in the localized form.
+
+// Formatter contains all the information needed to render a number.
+type Formatter struct {
+	Pattern
+	Info
+}
+
+func (f *Formatter) init(t language.Tag, index []uint8) {
+	f.Info = InfoFromTag(t)
+	f.Pattern = formats[index[tagToID(t)]]
+}
+
+// InitPattern initializes a Formatter for the given Pattern.
+func (f *Formatter) InitPattern(t language.Tag, pat *Pattern) {
+	f.Info = InfoFromTag(t)
+	f.Pattern = *pat
+}
+
+// InitDecimal initializes a Formatter using the default Pattern for the given
+// language.
+func (f *Formatter) InitDecimal(t language.Tag) {
+	f.init(t, tagToDecimal)
+}
+
+// InitScientific initializes a Formatter using the default Pattern for the
+// given language.
+func (f *Formatter) InitScientific(t language.Tag) {
+	f.init(t, tagToScientific)
+	f.Pattern.MinFractionDigits = 0
+	f.Pattern.MaxFractionDigits = -1
+}
+
+// InitEngineering initializes a Formatter using the default Pattern for the
+// given language.
+func (f *Formatter) InitEngineering(t language.Tag) {
+	f.init(t, tagToScientific)
+	f.Pattern.MinFractionDigits = 0
+	f.Pattern.MaxFractionDigits = -1
+	f.Pattern.MaxIntegerDigits = 3
+	f.Pattern.MinIntegerDigits = 1
+}
+
+// InitPercent initializes a Formatter using the default Pattern for the given
+// language.
+func (f *Formatter) InitPercent(t language.Tag) {
+	f.init(t, tagToPercent)
+}
+
+// InitPerMille initializes a Formatter using the default Pattern for the given
+// language.
+func (f *Formatter) InitPerMille(t language.Tag) {
+	f.init(t, tagToPercent)
+	f.Pattern.DigitShift = 3
+}
+
+func (f *Formatter) Append(dst []byte, x interface{}) []byte {
+	var d Decimal
+	r := f.RoundingContext
+	d.Convert(r, x)
+	return f.Render(dst, FormatDigits(&d, r))
+}
+
+func FormatDigits(d *Decimal, r RoundingContext) Digits {
+	if r.isScientific() {
+		return scientificVisibleDigits(r, d)
+	}
+	return decimalVisibleDigits(r, d)
+}
+
+func (f *Formatter) Format(dst []byte, d *Decimal) []byte {
+	return f.Render(dst, FormatDigits(d, f.RoundingContext))
+}
+
+func (f *Formatter) Render(dst []byte, d Digits) []byte {
+	var result []byte
+	var postPrefix, preSuffix int
+	if d.IsScientific {
+		result, postPrefix, preSuffix = appendScientific(dst, f, &d)
+	} else {
+		result, postPrefix, preSuffix = appendDecimal(dst, f, &d)
+	}
+	if f.PadRune == 0 {
+		return result
+	}
+	width := int(f.FormatWidth)
+	if count := utf8.RuneCount(result); count < width {
+		insertPos := 0
+		switch f.Flags & PadMask {
+		case PadAfterPrefix:
+			insertPos = postPrefix
+		case PadBeforeSuffix:
+			insertPos = preSuffix
+		case PadAfterSuffix:
+			insertPos = len(result)
+		}
+		num := width - count
+		pad := [utf8.UTFMax]byte{' '}
+		sz := 1
+		if r := f.PadRune; r != 0 {
+			sz = utf8.EncodeRune(pad[:], r)
+		}
+		extra := sz * num
+		if n := len(result) + extra; n < cap(result) {
+			result = result[:n]
+			copy(result[insertPos+extra:], result[insertPos:])
+		} else {
+			buf := make([]byte, n)
+			copy(buf, result[:insertPos])
+			copy(buf[insertPos+extra:], result[insertPos:])
+			result = buf
+		}
+		for ; num > 0; num-- {
+			insertPos += copy(result[insertPos:], pad[:sz])
+		}
+	}
+	return result
+}
+
+// decimalVisibleDigits converts d according to the RoundingContext. Note that
+// the exponent may change as a result of this operation.
+func decimalVisibleDigits(r RoundingContext, d *Decimal) Digits {
+	if d.NaN || d.Inf {
+		return Digits{digits: digits{Neg: d.Neg, NaN: d.NaN, Inf: d.Inf}}
+	}
+	n := Digits{digits: d.normalize().digits}
+
+	exp := n.Exp
+	exp += int32(r.DigitShift)
+
+	// Cap integer digits. Remove *most-significant* digits.
+	if r.MaxIntegerDigits > 0 {
+		if p := int(exp) - int(r.MaxIntegerDigits); p > 0 {
+			if p > len(n.Digits) {
+				p = len(n.Digits)
+			}
+			if n.Digits = n.Digits[p:]; len(n.Digits) == 0 {
+				exp = 0
+			} else {
+				exp -= int32(p)
+			}
+			// Strip leading zeros.
+			for len(n.Digits) > 0 && n.Digits[0] == 0 {
+				n.Digits = n.Digits[1:]
+				exp--
+			}
+		}
+	}
+
+	// Rounding if not already done by Convert.
+	p := len(n.Digits)
+	if maxSig := int(r.MaxSignificantDigits); maxSig > 0 {
+		p = maxSig
+	}
+	if maxFrac := int(r.MaxFractionDigits); maxFrac >= 0 {
+		if cap := int(exp) + maxFrac; cap < p {
+			p = int(exp) + maxFrac
+		}
+		if p < 0 {
+			p = 0
+		}
+	}
+	n.round(r.Mode, p)
+
+	// set End (trailing zeros)
+	n.End = int32(len(n.Digits))
+	if n.End == 0 {
+		exp = 0
+		if r.MinFractionDigits > 0 {
+			n.End = int32(r.MinFractionDigits)
+		}
+		if p := int32(r.MinSignificantDigits) - 1; p > n.End {
+			n.End = p
+		}
+	} else {
+		if end := exp + int32(r.MinFractionDigits); end > n.End {
+			n.End = end
+		}
+		if n.End < int32(r.MinSignificantDigits) {
+			n.End = int32(r.MinSignificantDigits)
+		}
+	}
+	n.Exp = exp
+	return n
+}
+
+// appendDecimal appends a formatted number to dst. It returns two possible
+// insertion points for padding.
+func appendDecimal(dst []byte, f *Formatter, n *Digits) (b []byte, postPre, preSuf int) {
+	if dst, ok := f.renderSpecial(dst, n); ok {
+		return dst, 0, len(dst)
+	}
+	digits := n.Digits
+	exp := n.Exp
+
+	// Split in integer and fraction part.
+	var intDigits, fracDigits []byte
+	numInt := 0
+	numFrac := int(n.End - n.Exp)
+	if exp > 0 {
+		numInt = int(exp)
+		if int(exp) >= len(digits) { // ddddd | ddddd00
+			intDigits = digits
+		} else { // ddd.dd
+			intDigits = digits[:exp]
+			fracDigits = digits[exp:]
+		}
+	} else {
+		fracDigits = digits
+	}
+
+	neg := n.Neg
+	affix, suffix := f.getAffixes(neg)
+	dst = appendAffix(dst, f, affix, neg)
+	savedLen := len(dst)
+
+	minInt := int(f.MinIntegerDigits)
+	if minInt == 0 && f.MinSignificantDigits > 0 {
+		minInt = 1
+	}
+	// add leading zeros
+	for i := minInt; i > numInt; i-- {
+		dst = f.AppendDigit(dst, 0)
+		if f.needsSep(i) {
+			dst = append(dst, f.Symbol(SymGroup)...)
+		}
+	}
+	i := 0
+	for ; i < len(intDigits); i++ {
+		dst = f.AppendDigit(dst, intDigits[i])
+		if f.needsSep(numInt - i) {
+			dst = append(dst, f.Symbol(SymGroup)...)
+		}
+	}
+	for ; i < numInt; i++ {
+		dst = f.AppendDigit(dst, 0)
+		if f.needsSep(numInt - i) {
+			dst = append(dst, f.Symbol(SymGroup)...)
+		}
+	}
+
+	if numFrac > 0 || f.Flags&AlwaysDecimalSeparator != 0 {
+		dst = append(dst, f.Symbol(SymDecimal)...)
+	}
+	// Add trailing zeros
+	i = 0
+	for n := -int(n.Exp); i < n; i++ {
+		dst = f.AppendDigit(dst, 0)
+	}
+	for _, d := range fracDigits {
+		i++
+		dst = f.AppendDigit(dst, d)
+	}
+	for ; i < numFrac; i++ {
+		dst = f.AppendDigit(dst, 0)
+	}
+	return appendAffix(dst, f, suffix, neg), savedLen, len(dst)
+}
+
+func scientificVisibleDigits(r RoundingContext, d *Decimal) Digits {
+	if d.NaN || d.Inf {
+		return Digits{digits: digits{Neg: d.Neg, NaN: d.NaN, Inf: d.Inf}}
+	}
+	n := Digits{digits: d.normalize().digits, IsScientific: true}
+
+	// Normalize to have at least one digit. This simplifies engineering
+	// notation.
+	if len(n.Digits) == 0 {
+		n.Digits = append(n.Digits, 0)
+		n.Exp = 1
+	}
+
+	// Significant digits are transformed by the parser for scientific notation
+	// and do not need to be handled here.
+	maxInt, numInt := int(r.MaxIntegerDigits), int(r.MinIntegerDigits)
+	if numInt == 0 {
+		numInt = 1
+	}
+
+	// If a maximum number of integers is specified, the minimum must be 1
+	// and the exponent is grouped by this number (e.g. for engineering)
+	if maxInt > numInt {
+		// Correct the exponent to reflect a single integer digit.
+		numInt = 1
+		// engineering
+		// 0.01234 ([12345]e-1) -> 1.2345e-2  12.345e-3
+		// 12345   ([12345]e+5) -> 1.2345e4  12.345e3
+		d := int(n.Exp-1) % maxInt
+		if d < 0 {
+			d += maxInt
+		}
+		numInt += d
+	}
+
+	p := len(n.Digits)
+	if maxSig := int(r.MaxSignificantDigits); maxSig > 0 {
+		p = maxSig
+	}
+	if maxFrac := int(r.MaxFractionDigits); maxFrac >= 0 && numInt+maxFrac < p {
+		p = numInt + maxFrac
+	}
+	n.round(r.Mode, p)
+
+	n.Comma = uint8(numInt)
+	n.End = int32(len(n.Digits))
+	if minSig := int32(r.MinFractionDigits) + int32(numInt); n.End < minSig {
+		n.End = minSig
+	}
+	return n
+}
+
+// appendScientific appends a formatted number to dst. It returns two possible
+// insertion points for padding.
+func appendScientific(dst []byte, f *Formatter, n *Digits) (b []byte, postPre, preSuf int) {
+	if dst, ok := f.renderSpecial(dst, n); ok {
+		return dst, 0, 0
+	}
+	digits := n.Digits
+	numInt := int(n.Comma)
+	numFrac := int(n.End) - int(n.Comma)
+
+	var intDigits, fracDigits []byte
+	if numInt <= len(digits) {
+		intDigits = digits[:numInt]
+		fracDigits = digits[numInt:]
+	} else {
+		intDigits = digits
+	}
+	neg := n.Neg
+	affix, suffix := f.getAffixes(neg)
+	dst = appendAffix(dst, f, affix, neg)
+	savedLen := len(dst)
+
+	i := 0
+	for ; i < len(intDigits); i++ {
+		dst = f.AppendDigit(dst, intDigits[i])
+		if f.needsSep(numInt - i) {
+			dst = append(dst, f.Symbol(SymGroup)...)
+		}
+	}
+	for ; i < numInt; i++ {
+		dst = f.AppendDigit(dst, 0)
+		if f.needsSep(numInt - i) {
+			dst = append(dst, f.Symbol(SymGroup)...)
+		}
+	}
+
+	if numFrac > 0 || f.Flags&AlwaysDecimalSeparator != 0 {
+		dst = append(dst, f.Symbol(SymDecimal)...)
+	}
+	i = 0
+	for ; i < len(fracDigits); i++ {
+		dst = f.AppendDigit(dst, fracDigits[i])
+	}
+	for ; i < numFrac; i++ {
+		dst = f.AppendDigit(dst, 0)
+	}
+
+	// exp
+	buf := [12]byte{}
+	// TODO: use exponential if superscripting is not available (no Latin
+	// numbers or no tags) and use exponential in all other cases.
+	exp := n.Exp - int32(n.Comma)
+	exponential := f.Symbol(SymExponential)
+	if exponential == "E" {
+		dst = append(dst, "\u202f"...) // NARROW NO-BREAK SPACE
+		dst = append(dst, f.Symbol(SymSuperscriptingExponent)...)
+		dst = append(dst, "\u202f"...) // NARROW NO-BREAK SPACE
+		dst = f.AppendDigit(dst, 1)
+		dst = f.AppendDigit(dst, 0)
+		switch {
+		case exp < 0:
+			dst = append(dst, superMinus...)
+			exp = -exp
+		case f.Flags&AlwaysExpSign != 0:
+			dst = append(dst, superPlus...)
+		}
+		b = strconv.AppendUint(buf[:0], uint64(exp), 10)
+		for i := len(b); i < int(f.MinExponentDigits); i++ {
+			dst = append(dst, superDigits[0]...)
+		}
+		for _, c := range b {
+			dst = append(dst, superDigits[c-'0']...)
+		}
+	} else {
+		dst = append(dst, exponential...)
+		switch {
+		case exp < 0:
+			dst = append(dst, f.Symbol(SymMinusSign)...)
+			exp = -exp
+		case f.Flags&AlwaysExpSign != 0:
+			dst = append(dst, f.Symbol(SymPlusSign)...)
+		}
+		b = strconv.AppendUint(buf[:0], uint64(exp), 10)
+		for i := len(b); i < int(f.MinExponentDigits); i++ {
+			dst = f.AppendDigit(dst, 0)
+		}
+		for _, c := range b {
+			dst = f.AppendDigit(dst, c-'0')
+		}
+	}
+	return appendAffix(dst, f, suffix, neg), savedLen, len(dst)
+}
+
+const (
+	superMinus = "\u207B" // SUPERSCRIPT HYPHEN-MINUS
+	superPlus  = "\u207A" // SUPERSCRIPT PLUS SIGN
+)
+
+var (
+	// Note: the digits are not sequential!!!
+	superDigits = []string{
+		"\u2070", // SUPERSCRIPT DIGIT ZERO
+		"\u00B9", // SUPERSCRIPT DIGIT ONE
+		"\u00B2", // SUPERSCRIPT DIGIT TWO
+		"\u00B3", // SUPERSCRIPT DIGIT THREE
+		"\u2074", // SUPERSCRIPT DIGIT FOUR
+		"\u2075", // SUPERSCRIPT DIGIT FIVE
+		"\u2076", // SUPERSCRIPT DIGIT SIX
+		"\u2077", // SUPERSCRIPT DIGIT SEVEN
+		"\u2078", // SUPERSCRIPT DIGIT EIGHT
+		"\u2079", // SUPERSCRIPT DIGIT NINE
+	}
+)
+
+func (f *Formatter) getAffixes(neg bool) (affix, suffix string) {
+	str := f.Affix
+	if str != "" {
+		if f.NegOffset > 0 {
+			if neg {
+				str = str[f.NegOffset:]
+			} else {
+				str = str[:f.NegOffset]
+			}
+		}
+		sufStart := 1 + str[0]
+		affix = str[1:sufStart]
+		suffix = str[sufStart+1:]
+	}
+	// TODO: introduce a NeedNeg sign to indicate if the left pattern already
+	// has a sign marked?
+	if f.NegOffset == 0 && (neg || f.Flags&AlwaysSign != 0) {
+		affix = "-" + affix
+	}
+	return affix, suffix
+}
+
+func (f *Formatter) renderSpecial(dst []byte, d *Digits) (b []byte, ok bool) {
+	if d.NaN {
+		return fmtNaN(dst, f), true
+	}
+	if d.Inf {
+		return fmtInfinite(dst, f, d), true
+	}
+	return dst, false
+}
+
+func fmtNaN(dst []byte, f *Formatter) []byte {
+	return append(dst, f.Symbol(SymNan)...)
+}
+
+func fmtInfinite(dst []byte, f *Formatter, d *Digits) []byte {
+	affix, suffix := f.getAffixes(d.Neg)
+	dst = appendAffix(dst, f, affix, d.Neg)
+	dst = append(dst, f.Symbol(SymInfinity)...)
+	dst = appendAffix(dst, f, suffix, d.Neg)
+	return dst
+}
+
+func appendAffix(dst []byte, f *Formatter, affix string, neg bool) []byte {
+	quoting := false
+	escaping := false
+	for _, r := range affix {
+		switch {
+		case escaping:
+			// escaping occurs both inside and outside of quotes
+			dst = append(dst, string(r)...)
+			escaping = false
+		case r == '\\':
+			escaping = true
+		case r == '\'':
+			quoting = !quoting
+		case quoting:
+			dst = append(dst, string(r)...)
+		case r == '%':
+			if f.DigitShift == 3 {
+				dst = append(dst, f.Symbol(SymPerMille)...)
+			} else {
+				dst = append(dst, f.Symbol(SymPercentSign)...)
+			}
+		case r == '-' || r == '+':
+			if neg {
+				dst = append(dst, f.Symbol(SymMinusSign)...)
+			} else if f.Flags&ElideSign == 0 {
+				dst = append(dst, f.Symbol(SymPlusSign)...)
+			} else {
+				dst = append(dst, ' ')
+			}
+		default:
+			dst = append(dst, string(r)...)
+		}
+	}
+	return dst
+}
diff --git a/vendor/golang.org/x/text/internal/number/number.go b/vendor/golang.org/x/text/internal/number/number.go
new file mode 100644
index 0000000..e1d933c
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/number/number.go
@@ -0,0 +1,152 @@
+// Copyright 2016 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go
+
+// Package number contains tools and data for formatting numbers.
+package number
+
+import (
+	"unicode/utf8"
+
+	"golang.org/x/text/internal/language/compact"
+	"golang.org/x/text/language"
+)
+
+// Info holds number formatting configuration data.
+type Info struct {
+	system   systemData // numbering system information
+	symIndex symOffset  // index to symbols
+}
+
+// InfoFromLangID returns a Info for the given compact language identifier and
+// numbering system identifier. If system is the empty string, the default
+// numbering system will be taken for that language.
+func InfoFromLangID(compactIndex compact.ID, numberSystem string) Info {
+	p := langToDefaults[compactIndex]
+	// Lookup the entry for the language.
+	pSymIndex := symOffset(0) // Default: Latin, default symbols
+	system, ok := systemMap[numberSystem]
+	if !ok {
+		// Take the value for the default numbering system. This is by far the
+		// most common case as an alternative numbering system is hardly used.
+		if p&hasNonLatnMask == 0 { // Latn digits.
+			pSymIndex = p
+		} else { // Non-Latn or multiple numbering systems.
+			// Take the first entry from the alternatives list.
+			data := langToAlt[p&^hasNonLatnMask]
+			pSymIndex = data.symIndex
+			system = data.system
+		}
+	} else {
+		langIndex := compactIndex
+		ns := system
+	outerLoop:
+		for ; ; p = langToDefaults[langIndex] {
+			if p&hasNonLatnMask == 0 {
+				if ns == 0 {
+					// The index directly points to the symbol data.
+					pSymIndex = p
+					break
+				}
+				// Move to the parent and retry.
+				langIndex = langIndex.Parent()
+			} else {
+				// The index points to a list of symbol data indexes.
+				for _, e := range langToAlt[p&^hasNonLatnMask:] {
+					if e.compactTag != langIndex {
+						if langIndex == 0 {
+							// The CLDR root defines full symbol information for
+							// all numbering systems (even though mostly by
+							// means of aliases). Fall back to the default entry
+							// for Latn if there is no data for the numbering
+							// system of this language.
+							if ns == 0 {
+								break
+							}
+							// Fall back to Latin and start from the original
+							// language. See
+							// https://unicode.org/reports/tr35/#Locale_Inheritance.
+							ns = numLatn
+							langIndex = compactIndex
+							continue outerLoop
+						}
+						// Fall back to parent.
+						langIndex = langIndex.Parent()
+					} else if e.system == ns {
+						pSymIndex = e.symIndex
+						break outerLoop
+					}
+				}
+			}
+		}
+	}
+	if int(system) >= len(numSysData) { // algorithmic
+		// Will generate ASCII digits in case the user inadvertently calls
+		// WriteDigit or Digit on it.
+		d := numSysData[0]
+		d.id = system
+		return Info{
+			system:   d,
+			symIndex: pSymIndex,
+		}
+	}
+	return Info{
+		system:   numSysData[system],
+		symIndex: pSymIndex,
+	}
+}
+
+// InfoFromTag returns a Info for the given language tag.
+func InfoFromTag(t language.Tag) Info {
+	return InfoFromLangID(tagToID(t), t.TypeForKey("nu"))
+}
+
+// IsDecimal reports if the numbering system can convert decimal to native
+// symbols one-to-one.
+func (n Info) IsDecimal() bool {
+	return int(n.system.id) < len(numSysData)
+}
+
+// WriteDigit writes the UTF-8 sequence for n corresponding to the given ASCII
+// digit to dst and reports the number of bytes written. dst must be large
+// enough to hold the rune (can be up to utf8.UTFMax bytes).
+func (n Info) WriteDigit(dst []byte, asciiDigit rune) int {
+	copy(dst, n.system.zero[:n.system.digitSize])
+	dst[n.system.digitSize-1] += byte(asciiDigit - '0')
+	return int(n.system.digitSize)
+}
+
+// AppendDigit appends the UTF-8 sequence for n corresponding to the given digit
+// to dst and reports the number of bytes written. dst must be large enough to
+// hold the rune (can be up to utf8.UTFMax bytes).
+func (n Info) AppendDigit(dst []byte, digit byte) []byte {
+	dst = append(dst, n.system.zero[:n.system.digitSize]...)
+	dst[len(dst)-1] += digit
+	return dst
+}
+
+// Digit returns the digit for the numbering system for the corresponding ASCII
+// value. For example, ni.Digit('3') could return '三'. Note that the argument
+// is the rune constant '3', which equals 51, not the integer constant 3.
+func (n Info) Digit(asciiDigit rune) rune {
+	var x [utf8.UTFMax]byte
+	n.WriteDigit(x[:], asciiDigit)
+	r, _ := utf8.DecodeRune(x[:])
+	return r
+}
+
+// Symbol returns the string for the given symbol type.
+func (n Info) Symbol(t SymbolType) string {
+	return symData.Elem(int(symIndex[n.symIndex][t]))
+}
+
+func formatForLang(t language.Tag, index []byte) *Pattern {
+	return &formats[index[tagToID(t)]]
+}
+
+func tagToID(t language.Tag) compact.ID {
+	id, _ := compact.RegionalID(compact.Tag(t))
+	return id
+}
diff --git a/vendor/golang.org/x/text/internal/number/pattern.go b/vendor/golang.org/x/text/internal/number/pattern.go
new file mode 100644
index 0000000..06e5955
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/number/pattern.go
@@ -0,0 +1,485 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package number
+
+import (
+	"errors"
+	"unicode/utf8"
+)
+
+// This file contains a parser for the CLDR number patterns as described in
+// https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns.
+//
+// The following BNF is derived from this standard.
+//
+// pattern    := subpattern (';' subpattern)?
+// subpattern := affix? number exponent? affix?
+// number     := decimal | sigDigits
+// decimal    := '#'* '0'* ('.' fraction)? | '#' | '0'
+// fraction   := '0'* '#'*
+// sigDigits  := '#'* '@' '@'* '#'*
+// exponent   := 'E' '+'? '0'* '0'
+// padSpec    := '*' \L
+//
+// Notes:
+// - An affix pattern may contain any runes, but runes with special meaning
+//   should be escaped.
+// - Sequences of digits, '#', and '@' in decimal and sigDigits may have
+//   interstitial commas.
+
+// TODO: replace special characters in affixes (-, +, ¤) with control codes.
+
+// Pattern holds information for formatting numbers. It is designed to hold
+// information from CLDR number patterns.
+//
+// This pattern is precompiled  for all patterns for all languages. Even though
+// the number of patterns is not very large, we want to keep this small.
+//
+// This type is only intended for internal use.
+type Pattern struct {
+	RoundingContext
+
+	Affix       string // includes prefix and suffix. First byte is prefix length.
+	Offset      uint16 // Offset into Affix for prefix and suffix
+	NegOffset   uint16 // Offset into Affix for negative prefix and suffix or 0.
+	PadRune     rune
+	FormatWidth uint16
+
+	GroupingSize [2]uint8
+	Flags        PatternFlag
+}
+
+// A RoundingContext indicates how a number should be converted to digits.
+// It contains all information needed to determine the "visible digits" as
+// required by the pluralization rules.
+type RoundingContext struct {
+	// TODO: unify these two fields so that there is a more unambiguous meaning
+	// of how precision is handled.
+	MaxSignificantDigits int16 // -1 is unlimited
+	MaxFractionDigits    int16 // -1 is unlimited
+
+	Increment      uint32
+	IncrementScale uint8 // May differ from printed scale.
+
+	Mode RoundingMode
+
+	DigitShift uint8 // Number of decimals to shift. Used for % and ‰.
+
+	// Number of digits.
+	MinIntegerDigits uint8
+
+	MaxIntegerDigits     uint8
+	MinFractionDigits    uint8
+	MinSignificantDigits uint8
+
+	MinExponentDigits uint8
+}
+
+// RoundSignificantDigits returns the number of significant digits an
+// implementation of Convert may round to or n < 0 if there is no maximum or
+// a maximum is not recommended.
+func (r *RoundingContext) RoundSignificantDigits() (n int) {
+	if r.MaxFractionDigits == 0 && r.MaxSignificantDigits > 0 {
+		return int(r.MaxSignificantDigits)
+	} else if r.isScientific() && r.MaxIntegerDigits == 1 {
+		if r.MaxSignificantDigits == 0 ||
+			int(r.MaxFractionDigits+1) == int(r.MaxSignificantDigits) {
+			// Note: don't add DigitShift: it is only used for decimals.
+			return int(r.MaxFractionDigits) + 1
+		}
+	}
+	return -1
+}
+
+// RoundFractionDigits returns the number of fraction digits an implementation
+// of Convert may round to or n < 0 if there is no maximum or a maximum is not
+// recommended.
+func (r *RoundingContext) RoundFractionDigits() (n int) {
+	if r.MinExponentDigits == 0 &&
+		r.MaxSignificantDigits == 0 &&
+		r.MaxFractionDigits >= 0 {
+		return int(r.MaxFractionDigits) + int(r.DigitShift)
+	}
+	return -1
+}
+
+// SetScale fixes the RoundingContext to a fixed number of fraction digits.
+func (r *RoundingContext) SetScale(scale int) {
+	r.MinFractionDigits = uint8(scale)
+	r.MaxFractionDigits = int16(scale)
+}
+
+func (r *RoundingContext) SetPrecision(prec int) {
+	r.MaxSignificantDigits = int16(prec)
+}
+
+func (r *RoundingContext) isScientific() bool {
+	return r.MinExponentDigits > 0
+}
+
+func (f *Pattern) needsSep(pos int) bool {
+	p := pos - 1
+	size := int(f.GroupingSize[0])
+	if size == 0 || p == 0 {
+		return false
+	}
+	if p == size {
+		return true
+	}
+	if p -= size; p < 0 {
+		return false
+	}
+	// TODO: make second groupingsize the same as first if 0 so that we can
+	// avoid this check.
+	if x := int(f.GroupingSize[1]); x != 0 {
+		size = x
+	}
+	return p%size == 0
+}
+
+// A PatternFlag is a bit mask for the flag field of a Pattern.
+type PatternFlag uint8
+
+const (
+	AlwaysSign PatternFlag = 1 << iota
+	ElideSign              // Use space instead of plus sign. AlwaysSign must be true.
+	AlwaysExpSign
+	AlwaysDecimalSeparator
+	ParenthesisForNegative // Common pattern. Saves space.
+
+	PadAfterNumber
+	PadAfterAffix
+
+	PadBeforePrefix = 0 // Default
+	PadAfterPrefix  = PadAfterAffix
+	PadBeforeSuffix = PadAfterNumber
+	PadAfterSuffix  = PadAfterNumber | PadAfterAffix
+	PadMask         = PadAfterNumber | PadAfterAffix
+)
+
+type parser struct {
+	*Pattern
+
+	leadingSharps int
+
+	pos            int
+	err            error
+	doNotTerminate bool
+	groupingCount  uint
+	hasGroup       bool
+	buf            []byte
+}
+
+func (p *parser) setError(err error) {
+	if p.err == nil {
+		p.err = err
+	}
+}
+
+func (p *parser) updateGrouping() {
+	if p.hasGroup &&
+		0 < p.groupingCount && p.groupingCount < 255 {
+		p.GroupingSize[1] = p.GroupingSize[0]
+		p.GroupingSize[0] = uint8(p.groupingCount)
+	}
+	p.groupingCount = 0
+	p.hasGroup = true
+}
+
+var (
+	// TODO: more sensible and localizeable error messages.
+	errMultiplePadSpecifiers = errors.New("format: pattern has multiple pad specifiers")
+	errInvalidPadSpecifier   = errors.New("format: invalid pad specifier")
+	errInvalidQuote          = errors.New("format: invalid quote")
+	errAffixTooLarge         = errors.New("format: prefix or suffix exceeds maximum UTF-8 length of 256 bytes")
+	errDuplicatePercentSign  = errors.New("format: duplicate percent sign")
+	errDuplicatePermilleSign = errors.New("format: duplicate permille sign")
+	errUnexpectedEnd         = errors.New("format: unexpected end of pattern")
+)
+
+// ParsePattern extracts formatting information from a CLDR number pattern.
+//
+// See https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns.
+func ParsePattern(s string) (f *Pattern, err error) {
+	p := parser{Pattern: &Pattern{}}
+
+	s = p.parseSubPattern(s)
+
+	if s != "" {
+		// Parse negative sub pattern.
+		if s[0] != ';' {
+			p.setError(errors.New("format: error parsing first sub pattern"))
+			return nil, p.err
+		}
+		neg := parser{Pattern: &Pattern{}} // just for extracting the affixes.
+		s = neg.parseSubPattern(s[len(";"):])
+		p.NegOffset = uint16(len(p.buf))
+		p.buf = append(p.buf, neg.buf...)
+	}
+	if s != "" {
+		p.setError(errors.New("format: spurious characters at end of pattern"))
+	}
+	if p.err != nil {
+		return nil, p.err
+	}
+	if affix := string(p.buf); affix == "\x00\x00" || affix == "\x00\x00\x00\x00" {
+		// No prefix or suffixes.
+		p.NegOffset = 0
+	} else {
+		p.Affix = affix
+	}
+	if p.Increment == 0 {
+		p.IncrementScale = 0
+	}
+	return p.Pattern, nil
+}
+
+func (p *parser) parseSubPattern(s string) string {
+	s = p.parsePad(s, PadBeforePrefix)
+	s = p.parseAffix(s)
+	s = p.parsePad(s, PadAfterPrefix)
+
+	s = p.parse(p.number, s)
+	p.updateGrouping()
+
+	s = p.parsePad(s, PadBeforeSuffix)
+	s = p.parseAffix(s)
+	s = p.parsePad(s, PadAfterSuffix)
+	return s
+}
+
+func (p *parser) parsePad(s string, f PatternFlag) (tail string) {
+	if len(s) >= 2 && s[0] == '*' {
+		r, sz := utf8.DecodeRuneInString(s[1:])
+		if p.PadRune != 0 {
+			p.err = errMultiplePadSpecifiers
+		} else {
+			p.Flags |= f
+			p.PadRune = r
+		}
+		return s[1+sz:]
+	}
+	return s
+}
+
+func (p *parser) parseAffix(s string) string {
+	x := len(p.buf)
+	p.buf = append(p.buf, 0) // placeholder for affix length
+
+	s = p.parse(p.affix, s)
+
+	n := len(p.buf) - x - 1
+	if n > 0xFF {
+		p.setError(errAffixTooLarge)
+	}
+	p.buf[x] = uint8(n)
+	return s
+}
+
+// state implements a state transition. It returns the new state. A state
+// function may set an error on the parser or may simply return on an incorrect
+// token and let the next phase fail.
+type state func(r rune) state
+
+// parse repeatedly applies a state function on the given string until a
+// termination condition is reached.
+func (p *parser) parse(fn state, s string) (tail string) {
+	for i, r := range s {
+		p.doNotTerminate = false
+		if fn = fn(r); fn == nil || p.err != nil {
+			return s[i:]
+		}
+		p.FormatWidth++
+	}
+	if p.doNotTerminate {
+		p.setError(errUnexpectedEnd)
+	}
+	return ""
+}
+
+func (p *parser) affix(r rune) state {
+	switch r {
+	case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9',
+		'#', '@', '.', '*', ',', ';':
+		return nil
+	case '\'':
+		p.FormatWidth--
+		return p.escapeFirst
+	case '%':
+		if p.DigitShift != 0 {
+			p.setError(errDuplicatePercentSign)
+		}
+		p.DigitShift = 2
+	case '\u2030': // ‰ Per mille
+		if p.DigitShift != 0 {
+			p.setError(errDuplicatePermilleSign)
+		}
+		p.DigitShift = 3
+		// TODO: handle currency somehow: ¤, ¤¤, ¤¤¤, ¤¤¤¤
+	}
+	p.buf = append(p.buf, string(r)...)
+	return p.affix
+}
+
+func (p *parser) escapeFirst(r rune) state {
+	switch r {
+	case '\'':
+		p.buf = append(p.buf, "\\'"...)
+		return p.affix
+	default:
+		p.buf = append(p.buf, '\'')
+		p.buf = append(p.buf, string(r)...)
+	}
+	return p.escape
+}
+
+func (p *parser) escape(r rune) state {
+	switch r {
+	case '\'':
+		p.FormatWidth--
+		p.buf = append(p.buf, '\'')
+		return p.affix
+	default:
+		p.buf = append(p.buf, string(r)...)
+	}
+	return p.escape
+}
+
+// number parses a number. The BNF says the integer part should always have
+// a '0', but that does not appear to be the case according to the rest of the
+// documentation. We will allow having only '#' numbers.
+func (p *parser) number(r rune) state {
+	switch r {
+	case '#':
+		p.groupingCount++
+		p.leadingSharps++
+	case '@':
+		p.groupingCount++
+		p.leadingSharps = 0
+		p.MaxFractionDigits = -1
+		return p.sigDigits(r)
+	case ',':
+		if p.leadingSharps == 0 { // no leading commas
+			return nil
+		}
+		p.updateGrouping()
+	case 'E':
+		p.MaxIntegerDigits = uint8(p.leadingSharps)
+		return p.exponent
+	case '.': // allow ".##" etc.
+		p.updateGrouping()
+		return p.fraction
+	case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9':
+		return p.integer(r)
+	default:
+		return nil
+	}
+	return p.number
+}
+
+func (p *parser) integer(r rune) state {
+	if !('0' <= r && r <= '9') {
+		var next state
+		switch r {
+		case 'E':
+			if p.leadingSharps > 0 {
+				p.MaxIntegerDigits = uint8(p.leadingSharps) + p.MinIntegerDigits
+			}
+			next = p.exponent
+		case '.':
+			next = p.fraction
+		case ',':
+			next = p.integer
+		}
+		p.updateGrouping()
+		return next
+	}
+	p.Increment = p.Increment*10 + uint32(r-'0')
+	p.groupingCount++
+	p.MinIntegerDigits++
+	return p.integer
+}
+
+func (p *parser) sigDigits(r rune) state {
+	switch r {
+	case '@':
+		p.groupingCount++
+		p.MaxSignificantDigits++
+		p.MinSignificantDigits++
+	case '#':
+		return p.sigDigitsFinal(r)
+	case 'E':
+		p.updateGrouping()
+		return p.normalizeSigDigitsWithExponent()
+	default:
+		p.updateGrouping()
+		return nil
+	}
+	return p.sigDigits
+}
+
+func (p *parser) sigDigitsFinal(r rune) state {
+	switch r {
+	case '#':
+		p.groupingCount++
+		p.MaxSignificantDigits++
+	case 'E':
+		p.updateGrouping()
+		return p.normalizeSigDigitsWithExponent()
+	default:
+		p.updateGrouping()
+		return nil
+	}
+	return p.sigDigitsFinal
+}
+
+func (p *parser) normalizeSigDigitsWithExponent() state {
+	p.MinIntegerDigits, p.MaxIntegerDigits = 1, 1
+	p.MinFractionDigits = p.MinSignificantDigits - 1
+	p.MaxFractionDigits = p.MaxSignificantDigits - 1
+	p.MinSignificantDigits, p.MaxSignificantDigits = 0, 0
+	return p.exponent
+}
+
+func (p *parser) fraction(r rune) state {
+	switch r {
+	case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9':
+		p.Increment = p.Increment*10 + uint32(r-'0')
+		p.IncrementScale++
+		p.MinFractionDigits++
+		p.MaxFractionDigits++
+	case '#':
+		p.MaxFractionDigits++
+	case 'E':
+		if p.leadingSharps > 0 {
+			p.MaxIntegerDigits = uint8(p.leadingSharps) + p.MinIntegerDigits
+		}
+		return p.exponent
+	default:
+		return nil
+	}
+	return p.fraction
+}
+
+func (p *parser) exponent(r rune) state {
+	switch r {
+	case '+':
+		// Set mode and check it wasn't already set.
+		if p.Flags&AlwaysExpSign != 0 || p.MinExponentDigits > 0 {
+			break
+		}
+		p.Flags |= AlwaysExpSign
+		p.doNotTerminate = true
+		return p.exponent
+	case '0':
+		p.MinExponentDigits++
+		return p.exponent
+	}
+	// termination condition
+	if p.MinExponentDigits == 0 {
+		p.setError(errors.New("format: need at least one digit"))
+	}
+	return nil
+}
diff --git a/vendor/golang.org/x/text/internal/number/roundingmode_string.go b/vendor/golang.org/x/text/internal/number/roundingmode_string.go
new file mode 100644
index 0000000..bcc2247
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/number/roundingmode_string.go
@@ -0,0 +1,30 @@
+// Code generated by "stringer -type RoundingMode"; DO NOT EDIT.
+
+package number
+
+import "strconv"
+
+func _() {
+	// An "invalid array index" compiler error signifies that the constant values have changed.
+	// Re-run the stringer command to generate them again.
+	var x [1]struct{}
+	_ = x[ToNearestEven-0]
+	_ = x[ToNearestZero-1]
+	_ = x[ToNearestAway-2]
+	_ = x[ToPositiveInf-3]
+	_ = x[ToNegativeInf-4]
+	_ = x[ToZero-5]
+	_ = x[AwayFromZero-6]
+	_ = x[numModes-7]
+}
+
+const _RoundingMode_name = "ToNearestEvenToNearestZeroToNearestAwayToPositiveInfToNegativeInfToZeroAwayFromZeronumModes"
+
+var _RoundingMode_index = [...]uint8{0, 13, 26, 39, 52, 65, 71, 83, 91}
+
+func (i RoundingMode) String() string {
+	if i >= RoundingMode(len(_RoundingMode_index)-1) {
+		return "RoundingMode(" + strconv.FormatInt(int64(i), 10) + ")"
+	}
+	return _RoundingMode_name[_RoundingMode_index[i]:_RoundingMode_index[i+1]]
+}
diff --git a/vendor/golang.org/x/text/internal/number/tables.go b/vendor/golang.org/x/text/internal/number/tables.go
new file mode 100644
index 0000000..8efce81
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/number/tables.go
@@ -0,0 +1,1219 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package number
+
+import "golang.org/x/text/internal/stringset"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+var numSysData = []systemData{ // 59 elements
+	0:  {id: 0x0, digitSize: 0x1, zero: [4]uint8{0x30, 0x0, 0x0, 0x0}},
+	1:  {id: 0x1, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9e, 0xa5, 0x90}},
+	2:  {id: 0x2, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x9c, 0xb0}},
+	3:  {id: 0x3, digitSize: 0x2, zero: [4]uint8{0xd9, 0xa0, 0x0, 0x0}},
+	4:  {id: 0x4, digitSize: 0x2, zero: [4]uint8{0xdb, 0xb0, 0x0, 0x0}},
+	5:  {id: 0x5, digitSize: 0x3, zero: [4]uint8{0xe1, 0xad, 0x90, 0x0}},
+	6:  {id: 0x6, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa7, 0xa6, 0x0}},
+	7:  {id: 0x7, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xb1, 0x90}},
+	8:  {id: 0x8, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x81, 0xa6}},
+	9:  {id: 0x9, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x84, 0xb6}},
+	10: {id: 0xa, digitSize: 0x3, zero: [4]uint8{0xea, 0xa9, 0x90, 0x0}},
+	11: {id: 0xb, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa5, 0xa6, 0x0}},
+	12: {id: 0xc, digitSize: 0x3, zero: [4]uint8{0xef, 0xbc, 0x90, 0x0}},
+	13: {id: 0xd, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xb5, 0x90}},
+	14: {id: 0xe, digitSize: 0x3, zero: [4]uint8{0xe0, 0xab, 0xa6, 0x0}},
+	15: {id: 0xf, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa9, 0xa6, 0x0}},
+	16: {id: 0x10, digitSize: 0x4, zero: [4]uint8{0xf0, 0x96, 0xad, 0x90}},
+	17: {id: 0x11, digitSize: 0x3, zero: [4]uint8{0xea, 0xa7, 0x90, 0x0}},
+	18: {id: 0x12, digitSize: 0x3, zero: [4]uint8{0xea, 0xa4, 0x80, 0x0}},
+	19: {id: 0x13, digitSize: 0x3, zero: [4]uint8{0xe1, 0x9f, 0xa0, 0x0}},
+	20: {id: 0x14, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb3, 0xa6, 0x0}},
+	21: {id: 0x15, digitSize: 0x3, zero: [4]uint8{0xe1, 0xaa, 0x80, 0x0}},
+	22: {id: 0x16, digitSize: 0x3, zero: [4]uint8{0xe1, 0xaa, 0x90, 0x0}},
+	23: {id: 0x17, digitSize: 0x3, zero: [4]uint8{0xe0, 0xbb, 0x90, 0x0}},
+	24: {id: 0x18, digitSize: 0x3, zero: [4]uint8{0xe1, 0xb1, 0x80, 0x0}},
+	25: {id: 0x19, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa5, 0x86, 0x0}},
+	26: {id: 0x1a, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0x8e}},
+	27: {id: 0x1b, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0x98}},
+	28: {id: 0x1c, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xb6}},
+	29: {id: 0x1d, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xac}},
+	30: {id: 0x1e, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xa2}},
+	31: {id: 0x1f, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb5, 0xa6, 0x0}},
+	32: {id: 0x20, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x99, 0x90}},
+	33: {id: 0x21, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa0, 0x90, 0x0}},
+	34: {id: 0x22, digitSize: 0x4, zero: [4]uint8{0xf0, 0x96, 0xa9, 0xa0}},
+	35: {id: 0x23, digitSize: 0x3, zero: [4]uint8{0xea, 0xaf, 0xb0, 0x0}},
+	36: {id: 0x24, digitSize: 0x3, zero: [4]uint8{0xe1, 0x81, 0x80, 0x0}},
+	37: {id: 0x25, digitSize: 0x3, zero: [4]uint8{0xe1, 0x82, 0x90, 0x0}},
+	38: {id: 0x26, digitSize: 0x3, zero: [4]uint8{0xea, 0xa7, 0xb0, 0x0}},
+	39: {id: 0x27, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x91, 0x90}},
+	40: {id: 0x28, digitSize: 0x2, zero: [4]uint8{0xdf, 0x80, 0x0, 0x0}},
+	41: {id: 0x29, digitSize: 0x3, zero: [4]uint8{0xe1, 0xb1, 0x90, 0x0}},
+	42: {id: 0x2a, digitSize: 0x3, zero: [4]uint8{0xe0, 0xad, 0xa6, 0x0}},
+	43: {id: 0x2b, digitSize: 0x4, zero: [4]uint8{0xf0, 0x90, 0x92, 0xa0}},
+	44: {id: 0x2c, digitSize: 0x3, zero: [4]uint8{0xea, 0xa3, 0x90, 0x0}},
+	45: {id: 0x2d, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x87, 0x90}},
+	46: {id: 0x2e, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x8b, 0xb0}},
+	47: {id: 0x2f, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb7, 0xa6, 0x0}},
+	48: {id: 0x30, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x83, 0xb0}},
+	49: {id: 0x31, digitSize: 0x3, zero: [4]uint8{0xe1, 0xae, 0xb0, 0x0}},
+	50: {id: 0x32, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x9b, 0x80}},
+	51: {id: 0x33, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa7, 0x90, 0x0}},
+	52: {id: 0x34, digitSize: 0x3, zero: [4]uint8{0xe0, 0xaf, 0xa6, 0x0}},
+	53: {id: 0x35, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb1, 0xa6, 0x0}},
+	54: {id: 0x36, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb9, 0x90, 0x0}},
+	55: {id: 0x37, digitSize: 0x3, zero: [4]uint8{0xe0, 0xbc, 0xa0, 0x0}},
+	56: {id: 0x38, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x93, 0x90}},
+	57: {id: 0x39, digitSize: 0x3, zero: [4]uint8{0xea, 0x98, 0xa0, 0x0}},
+	58: {id: 0x3a, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xa3, 0xa0}},
+} // Size: 378 bytes
+
+const (
+	numAdlm     = 0x1
+	numAhom     = 0x2
+	numArab     = 0x3
+	numArabext  = 0x4
+	numArmn     = 0x3b
+	numArmnlow  = 0x3c
+	numBali     = 0x5
+	numBeng     = 0x6
+	numBhks     = 0x7
+	numBrah     = 0x8
+	numCakm     = 0x9
+	numCham     = 0xa
+	numCyrl     = 0x3d
+	numDeva     = 0xb
+	numEthi     = 0x3e
+	numFullwide = 0xc
+	numGeor     = 0x3f
+	numGonm     = 0xd
+	numGrek     = 0x40
+	numGreklow  = 0x41
+	numGujr     = 0xe
+	numGuru     = 0xf
+	numHanidays = 0x42
+	numHanidec  = 0x43
+	numHans     = 0x44
+	numHansfin  = 0x45
+	numHant     = 0x46
+	numHantfin  = 0x47
+	numHebr     = 0x48
+	numHmng     = 0x10
+	numJava     = 0x11
+	numJpan     = 0x49
+	numJpanfin  = 0x4a
+	numKali     = 0x12
+	numKhmr     = 0x13
+	numKnda     = 0x14
+	numLana     = 0x15
+	numLanatham = 0x16
+	numLaoo     = 0x17
+	numLatn     = 0x0
+	numLepc     = 0x18
+	numLimb     = 0x19
+	numMathbold = 0x1a
+	numMathdbl  = 0x1b
+	numMathmono = 0x1c
+	numMathsanb = 0x1d
+	numMathsans = 0x1e
+	numMlym     = 0x1f
+	numModi     = 0x20
+	numMong     = 0x21
+	numMroo     = 0x22
+	numMtei     = 0x23
+	numMymr     = 0x24
+	numMymrshan = 0x25
+	numMymrtlng = 0x26
+	numNewa     = 0x27
+	numNkoo     = 0x28
+	numOlck     = 0x29
+	numOrya     = 0x2a
+	numOsma     = 0x2b
+	numRoman    = 0x4b
+	numRomanlow = 0x4c
+	numSaur     = 0x2c
+	numShrd     = 0x2d
+	numSind     = 0x2e
+	numSinh     = 0x2f
+	numSora     = 0x30
+	numSund     = 0x31
+	numTakr     = 0x32
+	numTalu     = 0x33
+	numTaml     = 0x4d
+	numTamldec  = 0x34
+	numTelu     = 0x35
+	numThai     = 0x36
+	numTibt     = 0x37
+	numTirh     = 0x38
+	numVaii     = 0x39
+	numWara     = 0x3a
+	numNumberSystems
+)
+
+var systemMap = map[string]system{
+	"adlm":     numAdlm,
+	"ahom":     numAhom,
+	"arab":     numArab,
+	"arabext":  numArabext,
+	"armn":     numArmn,
+	"armnlow":  numArmnlow,
+	"bali":     numBali,
+	"beng":     numBeng,
+	"bhks":     numBhks,
+	"brah":     numBrah,
+	"cakm":     numCakm,
+	"cham":     numCham,
+	"cyrl":     numCyrl,
+	"deva":     numDeva,
+	"ethi":     numEthi,
+	"fullwide": numFullwide,
+	"geor":     numGeor,
+	"gonm":     numGonm,
+	"grek":     numGrek,
+	"greklow":  numGreklow,
+	"gujr":     numGujr,
+	"guru":     numGuru,
+	"hanidays": numHanidays,
+	"hanidec":  numHanidec,
+	"hans":     numHans,
+	"hansfin":  numHansfin,
+	"hant":     numHant,
+	"hantfin":  numHantfin,
+	"hebr":     numHebr,
+	"hmng":     numHmng,
+	"java":     numJava,
+	"jpan":     numJpan,
+	"jpanfin":  numJpanfin,
+	"kali":     numKali,
+	"khmr":     numKhmr,
+	"knda":     numKnda,
+	"lana":     numLana,
+	"lanatham": numLanatham,
+	"laoo":     numLaoo,
+	"latn":     numLatn,
+	"lepc":     numLepc,
+	"limb":     numLimb,
+	"mathbold": numMathbold,
+	"mathdbl":  numMathdbl,
+	"mathmono": numMathmono,
+	"mathsanb": numMathsanb,
+	"mathsans": numMathsans,
+	"mlym":     numMlym,
+	"modi":     numModi,
+	"mong":     numMong,
+	"mroo":     numMroo,
+	"mtei":     numMtei,
+	"mymr":     numMymr,
+	"mymrshan": numMymrshan,
+	"mymrtlng": numMymrtlng,
+	"newa":     numNewa,
+	"nkoo":     numNkoo,
+	"olck":     numOlck,
+	"orya":     numOrya,
+	"osma":     numOsma,
+	"roman":    numRoman,
+	"romanlow": numRomanlow,
+	"saur":     numSaur,
+	"shrd":     numShrd,
+	"sind":     numSind,
+	"sinh":     numSinh,
+	"sora":     numSora,
+	"sund":     numSund,
+	"takr":     numTakr,
+	"talu":     numTalu,
+	"taml":     numTaml,
+	"tamldec":  numTamldec,
+	"telu":     numTelu,
+	"thai":     numThai,
+	"tibt":     numTibt,
+	"tirh":     numTirh,
+	"vaii":     numVaii,
+	"wara":     numWara,
+}
+
+var symIndex = [][12]uint8{ // 81 elements
+	0:  [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	1:  [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	2:  [12]uint8{0x0, 0x1, 0x2, 0xd, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb},
+	3:  [12]uint8{0x1, 0x0, 0x2, 0xd, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb},
+	4:  [12]uint8{0x0, 0x1, 0x2, 0x11, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb},
+	5:  [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x12, 0xb},
+	6:  [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	7:  [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x13, 0xb},
+	8:  [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	9:  [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0},
+	10: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb},
+	11: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb},
+	12: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb},
+	13: [12]uint8{0x0, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	14: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x16, 0xb},
+	15: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb},
+	16: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0x0},
+	17: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb},
+	18: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0},
+	19: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x18, 0x7, 0x8, 0x9, 0xa, 0xb},
+	20: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x19, 0x1a, 0xa, 0xb},
+	21: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	22: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x7, 0x8, 0x9, 0xa, 0xb},
+	23: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	24: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0x1c, 0x6, 0x7, 0x8, 0x9, 0x1d, 0xb},
+	25: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0x1e, 0x0},
+	26: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	27: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	28: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x1f, 0xb},
+	29: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	30: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x20, 0xb},
+	31: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x21, 0x7, 0x8, 0x9, 0x22, 0xb},
+	32: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x23, 0xb},
+	33: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x14, 0x8, 0x9, 0x24, 0xb},
+	34: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x7, 0x8, 0x9, 0x24, 0xb},
+	35: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x25, 0xb},
+	36: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x26, 0xb},
+	37: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x27, 0xb},
+	38: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x28, 0xb},
+	39: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x29, 0xb},
+	40: [12]uint8{0x1, 0x0, 0x2, 0x3, 0xe, 0x1c, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	41: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2a, 0xb},
+	42: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2b, 0xb},
+	43: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x2c, 0x14, 0x8, 0x9, 0x24, 0xb},
+	44: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0},
+	45: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb},
+	46: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb},
+	47: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2d, 0x0},
+	48: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2e, 0xb},
+	49: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2f, 0xb},
+	50: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x30, 0x7, 0x8, 0x9, 0xa, 0xb},
+	51: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x31, 0xb},
+	52: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x32, 0xb},
+	53: [12]uint8{0x1, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb},
+	54: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x33, 0xb},
+	55: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x34, 0xb},
+	56: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb},
+	57: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0x3d, 0xb},
+	58: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb},
+	59: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb},
+	60: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x39, 0x40, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb},
+	61: [12]uint8{0x35, 0x36, 0x37, 0x41, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb},
+	62: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb},
+	63: [12]uint8{0x35, 0xc, 0x37, 0x38, 0x39, 0x42, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0x0},
+	64: [12]uint8{0x35, 0xc, 0x37, 0x38, 0x39, 0x42, 0x43, 0x7, 0x44, 0x9, 0x24, 0xb},
+	65: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x5, 0x3b, 0x7, 0x3c, 0x9, 0x33, 0xb},
+	66: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x45, 0x46, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35},
+	67: [12]uint8{0x35, 0x36, 0x37, 0x11, 0xe, 0x1c, 0x43, 0x7, 0x3c, 0x9, 0x1d, 0xb},
+	68: [12]uint8{0x35, 0x36, 0x37, 0x11, 0xe, 0x1c, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35},
+	69: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x45, 0x5, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35},
+	70: [12]uint8{0x1, 0xc, 0x37, 0x11, 0x45, 0x47, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x0},
+	71: [12]uint8{0x35, 0x1, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35},
+	72: [12]uint8{0x1, 0xc, 0x37, 0x11, 0x45, 0x47, 0x43, 0x7, 0x3c, 0x9, 0x24, 0xb},
+	73: [12]uint8{0x35, 0x36, 0x2, 0x3, 0x45, 0x46, 0x43, 0x7, 0x8, 0x9, 0xa, 0x35},
+	74: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0x31, 0x35},
+	75: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0x32, 0x35},
+	76: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x48, 0x46, 0x43, 0x7, 0x3c, 0x9, 0x33, 0x35},
+	77: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x49},
+	78: [12]uint8{0x0, 0x1, 0x4a, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x28, 0xb},
+	79: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x4b, 0xb},
+	80: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x4c, 0x4d, 0xb},
+} // Size: 996 bytes
+
+var symData = stringset.Set{
+	Data: "" + // Size: 599 bytes
+		".,;%+-E×‰∞NaN:\u00a0\u200e%\u200e\u200e+\u200e-ليس\u00a0رقمًا٪NDТерхьаш" +
+		"\u00a0дац·’mnne×10^0/00INF−\u200e−ناعددepälukuՈչԹარ\u00a0არის\u00a0რიცხვ" +
+		"იZMdMсан\u00a0емес¤¤¤сан\u00a0эмесບໍ່\u200bແມ່ນ\u200bໂຕ\u200bເລກNSဂဏန်" +
+		"းမဟုတ်သောННне\u00a0числочыыһыла\u00a0буотах·10^epilohosan\u00a0dälTFЕs" +
+		"on\u00a0emasҳақиқий\u00a0сон\u00a0эмас非數值非数值٫٬؛٪\u061c\u061c+\u061c-اس؉ل" +
+		"يس\u00a0رقم\u200f+\u200f-\u200f−٪\u200f\u061c−×۱۰^؉\u200f\u200e+\u200e" +
+		"\u200e-\u200e\u200e−\u200e+\u200e：၊ཨང་མེན་གྲངས་མེདཨང་མད",
+	Index: []uint16{ // 79 elements
+		// Entry 0 - 3F
+		0x0000, 0x0001, 0x0002, 0x0003, 0x0004, 0x0005, 0x0006, 0x0007,
+		0x0009, 0x000c, 0x000f, 0x0012, 0x0013, 0x0015, 0x001c, 0x0020,
+		0x0024, 0x0036, 0x0038, 0x003a, 0x0050, 0x0052, 0x0055, 0x0058,
+		0x0059, 0x005e, 0x0062, 0x0065, 0x0068, 0x006e, 0x0078, 0x0080,
+		0x0086, 0x00ae, 0x00af, 0x00b2, 0x00c2, 0x00c8, 0x00d8, 0x0105,
+		0x0107, 0x012e, 0x0132, 0x0142, 0x015e, 0x0163, 0x016a, 0x0173,
+		0x0175, 0x0177, 0x0180, 0x01a0, 0x01a9, 0x01b2, 0x01b4, 0x01b6,
+		0x01b8, 0x01bc, 0x01bf, 0x01c2, 0x01c6, 0x01c8, 0x01d6, 0x01da,
+		// Entry 40 - 7F
+		0x01de, 0x01e4, 0x01e9, 0x01ee, 0x01f5, 0x01fa, 0x0201, 0x0208,
+		0x0211, 0x0215, 0x0218, 0x021b, 0x0230, 0x0248, 0x0257,
+	},
+} // Size: 797 bytes
+
+// langToDefaults maps a compact language index to the default numbering system
+// and default symbol set
+var langToDefaults = [775]symOffset{
+	// Entry 0 - 3F
+	0x8000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x8003, 0x0002, 0x0002, 0x0002, 0x0002, 0x0003,
+	0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002,
+	0x0003, 0x0003, 0x0003, 0x0003, 0x0002, 0x0002, 0x0002, 0x0004,
+	0x0002, 0x0004, 0x0002, 0x0002, 0x0002, 0x0003, 0x0002, 0x0000,
+	0x8005, 0x0000, 0x0000, 0x0000, 0x8006, 0x0005, 0x0006, 0x0006,
+	0x0006, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000,
+	// Entry 40 - 7F
+	0x8009, 0x0000, 0x0000, 0x800a, 0x0000, 0x0000, 0x800c, 0x0001,
+	0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006,
+	0x0006, 0x0006, 0x0006, 0x0006, 0x800e, 0x0000, 0x0000, 0x0007,
+	0x0007, 0x0000, 0x0000, 0x0000, 0x0000, 0x800f, 0x0008, 0x0008,
+	0x8011, 0x0001, 0x0001, 0x0001, 0x803c, 0x0000, 0x0009, 0x0009,
+	0x0009, 0x0000, 0x0000, 0x000a, 0x000b, 0x000a, 0x000c, 0x000a,
+	0x000a, 0x000c, 0x000a, 0x000d, 0x000d, 0x000a, 0x000a, 0x0001,
+	0x0001, 0x0000, 0x0001, 0x0001, 0x803f, 0x0000, 0x0000, 0x0000,
+	// Entry 80 - BF
+	0x000e, 0x000e, 0x000e, 0x000f, 0x000f, 0x000f, 0x0000, 0x0000,
+	0x0006, 0x0000, 0x0000, 0x0000, 0x000a, 0x0010, 0x0000, 0x0006,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0011, 0x0000, 0x000a,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x000a, 0x0000, 0x0009, 0x0000,
+	0x0000, 0x0012, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	// Entry C0 - FF
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0013, 0x0000,
+	0x0000, 0x000f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0001, 0x0000, 0x0000, 0x0015,
+	0x0015, 0x0006, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, 0x0006,
+	0x0006, 0x0001, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006,
+	// Entry 100 - 13F
+	0x0000, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006,
+	0x0000, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0016, 0x0016,
+	0x0017, 0x0017, 0x0001, 0x0001, 0x8041, 0x0018, 0x0018, 0x0001,
+	0x0001, 0x0001, 0x0001, 0x0001, 0x0019, 0x0019, 0x0000, 0x0000,
+	0x0017, 0x0017, 0x0017, 0x8044, 0x0001, 0x0001, 0x0001, 0x0001,
+	0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
+	0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
+	0x0001, 0x0001, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001,
+	// Entry 140 - 17F
+	0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
+	0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
+	0x0001, 0x0001, 0x0006, 0x0006, 0x0006, 0x0006, 0x0000, 0x0000,
+	0x8047, 0x0000, 0x0006, 0x0006, 0x001a, 0x001a, 0x001a, 0x001a,
+	0x804a, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x804c, 0x001b, 0x0000,
+	0x0000, 0x0006, 0x0006, 0x0006, 0x000a, 0x000a, 0x0001, 0x0001,
+	0x001c, 0x001c, 0x0009, 0x0009, 0x804f, 0x0000, 0x0000, 0x0000,
+	// Entry 180 - 1BF
+	0x0000, 0x0000, 0x8052, 0x0006, 0x0006, 0x001d, 0x0006, 0x0006,
+	0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x001e, 0x001e, 0x001f,
+	0x001f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001,
+	0x0001, 0x000d, 0x000d, 0x0000, 0x0000, 0x0020, 0x0020, 0x0006,
+	0x0006, 0x0021, 0x0021, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000,
+	0x0000, 0x8054, 0x0000, 0x0000, 0x0000, 0x0000, 0x8056, 0x001b,
+	0x0000, 0x0000, 0x0001, 0x0001, 0x0022, 0x0022, 0x0000, 0x0000,
+	// Entry 1C0 - 1FF
+	0x0000, 0x0023, 0x0023, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006,
+	0x0024, 0x0024, 0x8058, 0x0000, 0x0000, 0x0016, 0x0016, 0x0006,
+	0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0025, 0x0025, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x000d, 0x000d, 0x0000, 0x0000,
+	0x0006, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x805a, 0x0000, 0x0000, 0x0006, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x805b, 0x0026, 0x805d,
+	// Entry 200 - 23F
+	0x0000, 0x0000, 0x0000, 0x0000, 0x805e, 0x0015, 0x0015, 0x0000,
+	0x0000, 0x0006, 0x0006, 0x0006, 0x8061, 0x0000, 0x0000, 0x8062,
+	0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0001,
+	0x0001, 0x0015, 0x0015, 0x0006, 0x0006, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0027, 0x0027, 0x0027, 0x8065, 0x8067,
+	0x001b, 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001,
+	0x8069, 0x0028, 0x0006, 0x0001, 0x0006, 0x0001, 0x0001, 0x0001,
+	// Entry 240 - 27F
+	0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000,
+	0x0006, 0x0000, 0x0000, 0x001a, 0x001a, 0x0006, 0x0006, 0x0006,
+	0x0006, 0x0006, 0x0000, 0x0000, 0x0029, 0x0029, 0x0029, 0x0029,
+	0x0029, 0x0029, 0x0029, 0x0006, 0x0006, 0x0000, 0x0000, 0x002a,
+	0x002a, 0x0000, 0x0000, 0x0000, 0x0000, 0x806b, 0x0000, 0x0000,
+	0x002b, 0x002b, 0x002b, 0x002b, 0x0006, 0x0006, 0x000d, 0x000d,
+	0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
+	0x002c, 0x002c, 0x002d, 0x002d, 0x002e, 0x002e, 0x0000, 0x0000,
+	// Entry 280 - 2BF
+	0x0000, 0x002f, 0x002f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0006,
+	0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006,
+	0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x806d, 0x0022, 0x0022,
+	0x0022, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0030, 0x0030, 0x0000, 0x0000, 0x8071, 0x0031, 0x0006,
+	// Entry 2C0 - 2FF
+	0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x000d, 0x000d, 0x0001,
+	0x0001, 0x0000, 0x0000, 0x0032, 0x0032, 0x8074, 0x8076, 0x001b,
+	0x8077, 0x8079, 0x0028, 0x807b, 0x0034, 0x0033, 0x0033, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0035, 0x0035, 0x0006, 0x0006,
+	0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0036, 0x0037, 0x0037, 0x0036, 0x0036, 0x0001,
+	0x0001, 0x807d, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x8080,
+	// Entry 300 - 33F
+	0x0036, 0x0036, 0x0036, 0x0000, 0x0000, 0x0006, 0x0014,
+} // Size: 1550 bytes
+
+// langToAlt is a list of numbering system and symbol set pairs, sorted and
+// marked by compact language index.
+var langToAlt = []altSymData{ // 131 elements
+	1:   {compactTag: 0x0, symIndex: 0x38, system: 0x3},
+	2:   {compactTag: 0x0, symIndex: 0x42, system: 0x4},
+	3:   {compactTag: 0xa, symIndex: 0x39, system: 0x3},
+	4:   {compactTag: 0xa, symIndex: 0x2, system: 0x0},
+	5:   {compactTag: 0x28, symIndex: 0x0, system: 0x6},
+	6:   {compactTag: 0x2c, symIndex: 0x5, system: 0x0},
+	7:   {compactTag: 0x2c, symIndex: 0x3a, system: 0x3},
+	8:   {compactTag: 0x2c, symIndex: 0x42, system: 0x4},
+	9:   {compactTag: 0x40, symIndex: 0x0, system: 0x6},
+	10:  {compactTag: 0x43, symIndex: 0x0, system: 0x0},
+	11:  {compactTag: 0x43, symIndex: 0x4f, system: 0x37},
+	12:  {compactTag: 0x46, symIndex: 0x1, system: 0x0},
+	13:  {compactTag: 0x46, symIndex: 0x38, system: 0x3},
+	14:  {compactTag: 0x54, symIndex: 0x0, system: 0x9},
+	15:  {compactTag: 0x5d, symIndex: 0x3a, system: 0x3},
+	16:  {compactTag: 0x5d, symIndex: 0x8, system: 0x0},
+	17:  {compactTag: 0x60, symIndex: 0x1, system: 0x0},
+	18:  {compactTag: 0x60, symIndex: 0x38, system: 0x3},
+	19:  {compactTag: 0x60, symIndex: 0x42, system: 0x4},
+	20:  {compactTag: 0x60, symIndex: 0x0, system: 0x5},
+	21:  {compactTag: 0x60, symIndex: 0x0, system: 0x6},
+	22:  {compactTag: 0x60, symIndex: 0x0, system: 0x8},
+	23:  {compactTag: 0x60, symIndex: 0x0, system: 0x9},
+	24:  {compactTag: 0x60, symIndex: 0x0, system: 0xa},
+	25:  {compactTag: 0x60, symIndex: 0x0, system: 0xb},
+	26:  {compactTag: 0x60, symIndex: 0x0, system: 0xc},
+	27:  {compactTag: 0x60, symIndex: 0x0, system: 0xd},
+	28:  {compactTag: 0x60, symIndex: 0x0, system: 0xe},
+	29:  {compactTag: 0x60, symIndex: 0x0, system: 0xf},
+	30:  {compactTag: 0x60, symIndex: 0x0, system: 0x11},
+	31:  {compactTag: 0x60, symIndex: 0x0, system: 0x12},
+	32:  {compactTag: 0x60, symIndex: 0x0, system: 0x13},
+	33:  {compactTag: 0x60, symIndex: 0x0, system: 0x14},
+	34:  {compactTag: 0x60, symIndex: 0x0, system: 0x15},
+	35:  {compactTag: 0x60, symIndex: 0x0, system: 0x16},
+	36:  {compactTag: 0x60, symIndex: 0x0, system: 0x17},
+	37:  {compactTag: 0x60, symIndex: 0x0, system: 0x18},
+	38:  {compactTag: 0x60, symIndex: 0x0, system: 0x19},
+	39:  {compactTag: 0x60, symIndex: 0x0, system: 0x1f},
+	40:  {compactTag: 0x60, symIndex: 0x0, system: 0x21},
+	41:  {compactTag: 0x60, symIndex: 0x0, system: 0x23},
+	42:  {compactTag: 0x60, symIndex: 0x0, system: 0x24},
+	43:  {compactTag: 0x60, symIndex: 0x0, system: 0x25},
+	44:  {compactTag: 0x60, symIndex: 0x0, system: 0x28},
+	45:  {compactTag: 0x60, symIndex: 0x0, system: 0x29},
+	46:  {compactTag: 0x60, symIndex: 0x0, system: 0x2a},
+	47:  {compactTag: 0x60, symIndex: 0x0, system: 0x2b},
+	48:  {compactTag: 0x60, symIndex: 0x0, system: 0x2c},
+	49:  {compactTag: 0x60, symIndex: 0x0, system: 0x2d},
+	50:  {compactTag: 0x60, symIndex: 0x0, system: 0x30},
+	51:  {compactTag: 0x60, symIndex: 0x0, system: 0x31},
+	52:  {compactTag: 0x60, symIndex: 0x0, system: 0x32},
+	53:  {compactTag: 0x60, symIndex: 0x0, system: 0x33},
+	54:  {compactTag: 0x60, symIndex: 0x0, system: 0x34},
+	55:  {compactTag: 0x60, symIndex: 0x0, system: 0x35},
+	56:  {compactTag: 0x60, symIndex: 0x0, system: 0x36},
+	57:  {compactTag: 0x60, symIndex: 0x0, system: 0x37},
+	58:  {compactTag: 0x60, symIndex: 0x0, system: 0x39},
+	59:  {compactTag: 0x60, symIndex: 0x0, system: 0x43},
+	60:  {compactTag: 0x64, symIndex: 0x0, system: 0x0},
+	61:  {compactTag: 0x64, symIndex: 0x38, system: 0x3},
+	62:  {compactTag: 0x64, symIndex: 0x42, system: 0x4},
+	63:  {compactTag: 0x7c, symIndex: 0x50, system: 0x37},
+	64:  {compactTag: 0x7c, symIndex: 0x0, system: 0x0},
+	65:  {compactTag: 0x114, symIndex: 0x43, system: 0x4},
+	66:  {compactTag: 0x114, symIndex: 0x18, system: 0x0},
+	67:  {compactTag: 0x114, symIndex: 0x3b, system: 0x3},
+	68:  {compactTag: 0x123, symIndex: 0x1, system: 0x0},
+	69:  {compactTag: 0x123, symIndex: 0x3c, system: 0x3},
+	70:  {compactTag: 0x123, symIndex: 0x44, system: 0x4},
+	71:  {compactTag: 0x158, symIndex: 0x0, system: 0x0},
+	72:  {compactTag: 0x158, symIndex: 0x3b, system: 0x3},
+	73:  {compactTag: 0x158, symIndex: 0x45, system: 0x4},
+	74:  {compactTag: 0x160, symIndex: 0x0, system: 0x0},
+	75:  {compactTag: 0x160, symIndex: 0x38, system: 0x3},
+	76:  {compactTag: 0x16d, symIndex: 0x1b, system: 0x0},
+	77:  {compactTag: 0x16d, symIndex: 0x0, system: 0x9},
+	78:  {compactTag: 0x16d, symIndex: 0x0, system: 0xa},
+	79:  {compactTag: 0x17c, symIndex: 0x0, system: 0x0},
+	80:  {compactTag: 0x17c, symIndex: 0x3d, system: 0x3},
+	81:  {compactTag: 0x17c, symIndex: 0x42, system: 0x4},
+	82:  {compactTag: 0x182, symIndex: 0x6, system: 0x0},
+	83:  {compactTag: 0x182, symIndex: 0x38, system: 0x3},
+	84:  {compactTag: 0x1b1, symIndex: 0x0, system: 0x0},
+	85:  {compactTag: 0x1b1, symIndex: 0x3e, system: 0x3},
+	86:  {compactTag: 0x1b6, symIndex: 0x42, system: 0x4},
+	87:  {compactTag: 0x1b6, symIndex: 0x1b, system: 0x0},
+	88:  {compactTag: 0x1d2, symIndex: 0x42, system: 0x4},
+	89:  {compactTag: 0x1d2, symIndex: 0x0, system: 0x0},
+	90:  {compactTag: 0x1f3, symIndex: 0x0, system: 0xb},
+	91:  {compactTag: 0x1fd, symIndex: 0x4e, system: 0x24},
+	92:  {compactTag: 0x1fd, symIndex: 0x26, system: 0x0},
+	93:  {compactTag: 0x1ff, symIndex: 0x42, system: 0x4},
+	94:  {compactTag: 0x204, symIndex: 0x15, system: 0x0},
+	95:  {compactTag: 0x204, symIndex: 0x3f, system: 0x3},
+	96:  {compactTag: 0x204, symIndex: 0x46, system: 0x4},
+	97:  {compactTag: 0x20c, symIndex: 0x0, system: 0xb},
+	98:  {compactTag: 0x20f, symIndex: 0x6, system: 0x0},
+	99:  {compactTag: 0x20f, symIndex: 0x38, system: 0x3},
+	100: {compactTag: 0x20f, symIndex: 0x42, system: 0x4},
+	101: {compactTag: 0x22e, symIndex: 0x0, system: 0x0},
+	102: {compactTag: 0x22e, symIndex: 0x47, system: 0x4},
+	103: {compactTag: 0x22f, symIndex: 0x42, system: 0x4},
+	104: {compactTag: 0x22f, symIndex: 0x1b, system: 0x0},
+	105: {compactTag: 0x238, symIndex: 0x42, system: 0x4},
+	106: {compactTag: 0x238, symIndex: 0x28, system: 0x0},
+	107: {compactTag: 0x265, symIndex: 0x38, system: 0x3},
+	108: {compactTag: 0x265, symIndex: 0x0, system: 0x0},
+	109: {compactTag: 0x29d, symIndex: 0x22, system: 0x0},
+	110: {compactTag: 0x29d, symIndex: 0x40, system: 0x3},
+	111: {compactTag: 0x29d, symIndex: 0x48, system: 0x4},
+	112: {compactTag: 0x29d, symIndex: 0x4d, system: 0xc},
+	113: {compactTag: 0x2bd, symIndex: 0x31, system: 0x0},
+	114: {compactTag: 0x2bd, symIndex: 0x3e, system: 0x3},
+	115: {compactTag: 0x2bd, symIndex: 0x42, system: 0x4},
+	116: {compactTag: 0x2cd, symIndex: 0x1b, system: 0x0},
+	117: {compactTag: 0x2cd, symIndex: 0x49, system: 0x4},
+	118: {compactTag: 0x2ce, symIndex: 0x49, system: 0x4},
+	119: {compactTag: 0x2d0, symIndex: 0x33, system: 0x0},
+	120: {compactTag: 0x2d0, symIndex: 0x4a, system: 0x4},
+	121: {compactTag: 0x2d1, symIndex: 0x42, system: 0x4},
+	122: {compactTag: 0x2d1, symIndex: 0x28, system: 0x0},
+	123: {compactTag: 0x2d3, symIndex: 0x34, system: 0x0},
+	124: {compactTag: 0x2d3, symIndex: 0x4b, system: 0x4},
+	125: {compactTag: 0x2f9, symIndex: 0x0, system: 0x0},
+	126: {compactTag: 0x2f9, symIndex: 0x38, system: 0x3},
+	127: {compactTag: 0x2f9, symIndex: 0x42, system: 0x4},
+	128: {compactTag: 0x2ff, symIndex: 0x36, system: 0x0},
+	129: {compactTag: 0x2ff, symIndex: 0x41, system: 0x3},
+	130: {compactTag: 0x2ff, symIndex: 0x4c, system: 0x4},
+} // Size: 810 bytes
+
+var tagToDecimal = []uint8{ // 775 elements
+	// Entry 0 - 3F
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry 40 - 7F
+	0x05, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01,
+	// Entry 80 - BF
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry C0 - FF
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry 100 - 13F
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry 140 - 17F
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05,
+	0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry 180 - 1BF
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x05,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry 1C0 - 1FF
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, 0x05,
+	0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry 200 - 23F
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x05, 0x01,
+	0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry 240 - 27F
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry 280 - 2BF
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05,
+	0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry 2C0 - 2FF
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	// Entry 300 - 33F
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x08,
+} // Size: 799 bytes
+
+var tagToScientific = []uint8{ // 775 elements
+	// Entry 0 - 3F
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 40 - 7F
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 80 - BF
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry C0 - FF
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 100 - 13F
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 140 - 17F
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c,
+	0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 180 - 1BF
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 1C0 - 1FF
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 200 - 23F
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c, 0x02,
+	0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 240 - 27F
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 280 - 2BF
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 2C0 - 2FF
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	// Entry 300 - 33F
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x09,
+} // Size: 799 bytes
+
+var tagToPercent = []uint8{ // 775 elements
+	// Entry 0 - 3F
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	// Entry 40 - 7F
+	0x06, 0x06, 0x06, 0x04, 0x04, 0x04, 0x03, 0x03,
+	0x06, 0x06, 0x03, 0x04, 0x04, 0x03, 0x03, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x03,
+	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03,
+	0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04, 0x03,
+	0x03, 0x04, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03,
+	0x03, 0x04, 0x04, 0x04, 0x07, 0x07, 0x04, 0x04,
+	// Entry 80 - BF
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x03, 0x04,
+	0x04, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	// Entry C0 - FF
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	// Entry 100 - 13F
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04,
+	0x0b, 0x0b, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x03, 0x03,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	// Entry 140 - 17F
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06,
+	0x06, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	// Entry 180 - 1BF
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x06,
+	0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04,
+	// Entry 1C0 - 1FF
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	// Entry 200 - 23F
+	0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x06, 0x04,
+	0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	// Entry 240 - 27F
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x03, 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04,
+	// Entry 280 - 2BF
+	0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03,
+	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06,
+	0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x0e,
+	// Entry 2C0 - 2FF
+	0x0e, 0x0e, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03,
+	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	// Entry 300 - 33F
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x0a,
+} // Size: 799 bytes
+
+var formats = []Pattern{Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+	MaxFractionDigits:    0,
+	Increment:            0x0,
+	IncrementScale:       0x0,
+	Mode:                 0x0,
+	DigitShift:           0x0,
+	MinIntegerDigits:     0x0,
+	MaxIntegerDigits:     0x0,
+	MinFractionDigits:    0x0,
+	MinSignificantDigits: 0x0,
+	MinExponentDigits:    0x0},
+	Affix:       "",
+	Offset:      0x0,
+	NegOffset:   0x0,
+	PadRune:     0,
+	FormatWidth: 0x0,
+	GroupingSize: [2]uint8{0x0,
+		0x0},
+	Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    3,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x0,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x9,
+		GroupingSize: [2]uint8{0x3,
+			0x0},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    0,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x0,
+		MinIntegerDigits:     0x0,
+		MaxIntegerDigits:     0x1,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x1},
+		Affix:       "",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x3,
+		GroupingSize: [2]uint8{0x0,
+			0x0},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    0,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x2,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "\x00\x03\u00a0%",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x7,
+		GroupingSize: [2]uint8{0x3,
+			0x0},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    0,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x2,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "\x00\x01%",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x6,
+		GroupingSize: [2]uint8{0x3,
+			0x0},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    3,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x0,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0xc,
+		GroupingSize: [2]uint8{0x3,
+			0x2},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    0,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x2,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "\x00\x01%",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x9,
+		GroupingSize: [2]uint8{0x3,
+			0x2},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    0,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x2,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "\x00\x03\u00a0%",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0xa,
+		GroupingSize: [2]uint8{0x3,
+			0x2},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    6,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x0,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x8,
+		GroupingSize: [2]uint8{0x0,
+			0x0},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    6,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x0,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x6,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x3},
+		Affix:       "",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0xd,
+		GroupingSize: [2]uint8{0x0,
+			0x0},
+		Flags: 0x4},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    0,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x2,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "\x00\x01%",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x2,
+		GroupingSize: [2]uint8{0x0,
+			0x0},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    0,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x2,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "\x03%\u00a0\x00",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x7,
+		GroupingSize: [2]uint8{0x3,
+			0x0},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    0,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x0,
+		MinIntegerDigits:     0x0,
+		MaxIntegerDigits:     0x1,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x1},
+		Affix:       "\x01[\x01]",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x5,
+		GroupingSize: [2]uint8{0x0,
+			0x0},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    0,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x0,
+		MinIntegerDigits:     0x0,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x1,
+		GroupingSize: [2]uint8{0x0,
+			0x0},
+		Flags: 0x0},
+	Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
+		MaxFractionDigits:    0,
+		Increment:            0x0,
+		IncrementScale:       0x0,
+		Mode:                 0x0,
+		DigitShift:           0x2,
+		MinIntegerDigits:     0x1,
+		MaxIntegerDigits:     0x0,
+		MinFractionDigits:    0x0,
+		MinSignificantDigits: 0x0,
+		MinExponentDigits:    0x0},
+		Affix:       "\x01%\x00",
+		Offset:      0x0,
+		NegOffset:   0x0,
+		PadRune:     0,
+		FormatWidth: 0x6,
+		GroupingSize: [2]uint8{0x3,
+			0x0},
+		Flags: 0x0}}
+
+// Total table size 8634 bytes (8KiB); checksum: 8F23386D
diff --git a/vendor/golang.org/x/text/internal/stringset/set.go b/vendor/golang.org/x/text/internal/stringset/set.go
new file mode 100644
index 0000000..bb2fffb
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/stringset/set.go
@@ -0,0 +1,86 @@
+// Copyright 2016 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package stringset provides a way to represent a collection of strings
+// compactly.
+package stringset
+
+import "sort"
+
+// A Set holds a collection of strings that can be looked up by an index number.
+type Set struct {
+	// These fields are exported to allow for code generation.
+
+	Data  string
+	Index []uint16
+}
+
+// Elem returns the string with index i. It panics if i is out of range.
+func (s *Set) Elem(i int) string {
+	return s.Data[s.Index[i]:s.Index[i+1]]
+}
+
+// Len returns the number of strings in the set.
+func (s *Set) Len() int {
+	return len(s.Index) - 1
+}
+
+// Search returns the index of the given string or -1 if it is not in the set.
+// The Set must have been created with strings in sorted order.
+func Search(s *Set, str string) int {
+	// TODO: optimize this if it gets used a lot.
+	n := len(s.Index) - 1
+	p := sort.Search(n, func(i int) bool {
+		return s.Elem(i) >= str
+	})
+	if p == n || str != s.Elem(p) {
+		return -1
+	}
+	return p
+}
+
+// A Builder constructs Sets.
+type Builder struct {
+	set   Set
+	index map[string]int
+}
+
+// NewBuilder returns a new and initialized Builder.
+func NewBuilder() *Builder {
+	return &Builder{
+		set: Set{
+			Index: []uint16{0},
+		},
+		index: map[string]int{},
+	}
+}
+
+// Set creates the set created so far.
+func (b *Builder) Set() Set {
+	return b.set
+}
+
+// Index returns the index for the given string, which must have been added
+// before.
+func (b *Builder) Index(s string) int {
+	return b.index[s]
+}
+
+// Add adds a string to the index. Strings that are added by a single Add will
+// be stored together, unless they match an existing string.
+func (b *Builder) Add(ss ...string) {
+	// First check if the string already exists.
+	for _, s := range ss {
+		if _, ok := b.index[s]; ok {
+			continue
+		}
+		b.index[s] = len(b.set.Index) - 1
+		b.set.Data += s
+		x := len(b.set.Data)
+		if x > 0xFFFF {
+			panic("Index too > 0xFFFF")
+		}
+		b.set.Index = append(b.set.Index, uint16(x))
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go
new file mode 100644
index 0000000..b5d3488
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/tag/tag.go
@@ -0,0 +1,100 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package tag contains functionality handling tags and related data.
+package tag // import "golang.org/x/text/internal/tag"
+
+import "sort"
+
+// An Index converts tags to a compact numeric value.
+//
+// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can
+// be used to store additional information about the tag.
+type Index string
+
+// Elem returns the element data at the given index.
+func (s Index) Elem(x int) string {
+	return string(s[x*4 : x*4+4])
+}
+
+// Index reports the index of the given key or -1 if it could not be found.
+// Only the first len(key) bytes from the start of the 4-byte entries will be
+// considered for the search and the first match in Index will be returned.
+func (s Index) Index(key []byte) int {
+	n := len(key)
+	// search the index of the first entry with an equal or higher value than
+	// key in s.
+	index := sort.Search(len(s)/4, func(i int) bool {
+		return cmp(s[i*4:i*4+n], key) != -1
+	})
+	i := index * 4
+	if cmp(s[i:i+len(key)], key) != 0 {
+		return -1
+	}
+	return index
+}
+
+// Next finds the next occurrence of key after index x, which must have been
+// obtained from a call to Index using the same key. It returns x+1 or -1.
+func (s Index) Next(key []byte, x int) int {
+	if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 {
+		return x
+	}
+	return -1
+}
+
+// cmp returns an integer comparing a and b lexicographically.
+func cmp(a Index, b []byte) int {
+	n := len(a)
+	if len(b) < n {
+		n = len(b)
+	}
+	for i, c := range b[:n] {
+		switch {
+		case a[i] > c:
+			return 1
+		case a[i] < c:
+			return -1
+		}
+	}
+	switch {
+	case len(a) < len(b):
+		return -1
+	case len(a) > len(b):
+		return 1
+	}
+	return 0
+}
+
+// Compare returns an integer comparing a and b lexicographically.
+func Compare(a string, b []byte) int {
+	return cmp(Index(a), b)
+}
+
+// FixCase reformats b to the same pattern of cases as form.
+// If returns false if string b is malformed.
+func FixCase(form string, b []byte) bool {
+	if len(form) != len(b) {
+		return false
+	}
+	for i, c := range b {
+		if form[i] <= 'Z' {
+			if c >= 'a' {
+				c -= 'z' - 'Z'
+			}
+			if c < 'A' || 'Z' < c {
+				return false
+			}
+		} else {
+			if c <= 'Z' {
+				c += 'z' - 'Z'
+			}
+			if c < 'a' || 'z' < c {
+				return false
+			}
+		}
+		b[i] = c
+	}
+	return true
+}
author	Thomas Voss <mail@thomasvoss.com>	2024-08-07 00:21:12 +0200
committer	Thomas Voss <mail@thomasvoss.com>	2024-08-07 00:21:12 +0200
commit	351c15d28e0444fd8a78c510a0c4d62ed433c758 (patch)
tree	b97aae6ec45c1b341075da147fb9e333246c19f7 /vendor/golang.org/x/text/internal